Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5170.t1
Gene name
Locationscaffold_12:88123..91226
Strand-
Gene length (bp)3103
Transcript length (bp)2709
Coding sequence length (bp)2709
Protein length (aa) 903

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 2.5E-66 214 382
PF08407 Chitin_synth_1N Chitin synthase N-terminal 6.5E-27 134 213
PF03142 Chitin_synth_2 Chitin synthase 2.2E-19 359 537
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.9E-09 360 590

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016758 hexosyltransferase activity No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016757 glycosyltransferase activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006040 amino sugar metabolic process No
GO:0006030 chitin metabolic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006022 aminoglycan metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 574 596 22
2 616 638 22
3 648 670 22
4 694 716 22
5 731 753 22
6 831 853 22
7 868 890 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 46.29 28.19 64.39
5d_25C Five days - 25 degrees Celsius 24.87 14.30 35.44
7d_25C Seven days - 25 degrees Celsius 25.20 14.35 36.05
10d_25C Ten days - 25 degrees Celsius 26.11 14.70 37.53
7d_15C Seven days - 15 degrees Celsius 29.11 14.95 43.27
7d_30C Seven days - 30 degrees Celsius 50.33 29.49 71.17

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.001278 yes
3d_25C 7d_25C 0.002761 yes
3d_25C 7d_15C 0.047696 yes
3d_25C 7d_30C 0.788254 no
3d_25C 10d_25C 0.008133 yes
5d_25C 7d_25C 0.973425 no
5d_25C 7d_15C 0.606698 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.894773 no
7d_25C 7d_15C 0.643757 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.925186 no
7d_15C 7d_30C 0.021921 yes
7d_15C 10d_25C 0.751420 no
7d_30C 10d_25C 0.003197 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5170.t1
MSFPQRSTSPHSPHSGDLSHSPQASETSVYGPREQAYGYEEKPENLDSQQSLLYRNQPSPFNASFDDPYASTDSL
RRYTLQDPGVTIFPDGPYQESAGGLNSRRSGIQSPMSETPSEAWQNRQAPVSGLRRYATRKIKLVQGSVLSVDYP
VPSAIQNAIQKEYRESEEGFPEEFTHLRYTAATCDPDEFTLRNGYNLRPAMYNRHTELLIAITYYNEDKVLTART
LHGVMQNIRDIVNLKKSEFWNKGGPAWQKIVCSLVFDGIDPCDKNTLDLLATVGIYQDGIMKRSVDGRETVAHIF
EYTTQLSVTPSQQLIRPQGNESSNLPPVQMIFCLKQKNSKKINSHRWLFNGFSRILNPEVVILIDAGTKPGKKSL
LALWESFYNDKNLGGSCGEIHAMLGQGWKNLMNPLVAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRYRAI
MGRPLEQYFHGDHTLSKQLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGFKWHLTYVKASKGETDVPEGAAEF
ISQRRRWLNGSFAASLYAMMHFGRIYKSGHNLLRLFFLHIQMTYNFMGLVMTWFSLASFWLTTTVIMDLVGTPSE
SNKNRGWPFGNEATPIVNNFLKYGYIFFLMLQFILALGNRPKGSRLAYTLSFMYFSIVQTYIMVLSFYLVKNAFT
GGTLDFSMDRGVSHFLKSFFGSSGAGIVLIALVSTYGIYFIASFLYMDPWHMFTSSWAYFAGMTCSINILMVYAF
CNWHDVSWGTKGSDKGDSLPVAETKKDDAKSNFIEEVDKPQADIDSQFESTVKRALEPYVEPEDNDEPSMDDGYK
AFRTNLVLIWIFSNLILALCITSEGITRLCLTNTSTLRTSKYFAAILWTTAGLSIFRFIGSLWFLGKSGILCCVS
RR*
Coding >Pro_DTO377G3_2|g5170.t1
ATGTCTTTTCCTCAGAGGAGCACATCGCCTCACTCGCCTCACTCAGGCGACCTATCTCATTCTCCCCAAGCCAGC
GAGACTAGCGTGTATGGTCCACGAGAGCAAGCGTACGGTTACGAGGAGAAACCCGAGAACCTCGACAGCCAGCAG
TCTTTGCTTTACCGAAACCAGCCTAGCCCTTTCAACGCTTCATTCGATGACCCATATGCCTCGACCGATTCCCTC
CGTCGCTACACACTACAGGACCCCGGAGTCACCATCTTCCCCGATGGTCCATACCAGGAGTCCGCAGGAGGACTC
AACAGCCGTCGTTCGGGTATTCAATCACCCATGTCTGAGACTCCGTCGGAAGCTTGGCAAAACCGACAGGCACCT
GTGTCAGGGCTGCGGCGTTATGCTACGCGAAAGATCAAGTTGGTCCAGGGCTCTGTGCTCAGTGTCGACTATCCA
GTTCCAAGCGCCATCCAGAATGCGATACAGAAGGAGTATCGGGAATCGGAGGAGGGCTTCCCGGAAGAATTCACG
CATCTGCGTTATACCGCGGCCACCTGTGATCCTGACGAGTTCACCCTACGAAACGGATACAATCTGCGACCGGCT
ATGTACAACCGACACACTGAGCTTTTGATCGCTATCACATATTACAACGAAGATAAAGTTCTGACCGCGCGGACG
CTCCACGGTGTCATGCAGAACATTCGAGATATCGTCAATTTGAAGAAGTCGGAATTCTGGAATAAGGGTGGCCCG
GCCTGGCAAAAGATTGTGTGCTCCTTGGTTTTTGATGGTATTGATCCTTGCGACAAAAATACACTCGACTTATTG
GCCACTGTTGGTATCTACCAAGATGGCATCATGAAGCGCTCCGTCGATGGTCGGGAAACCGTCGCACACATCTTC
GAATATACCACCCAACTCTCAGTTACACCAAGCCAACAGTTGATCCGGCCCCAGGGCAACGAGTCATCAAACCTT
CCTCCCGTTCAAATGATTTTCTGTCTGAAGCAGAAGAACAGTAAAAAGATTAACTCCCACCGCTGGCTCTTTAAC
GGTTTCAGCCGAATCCTTAACCCCGAAGTCGTGATTCTCATTGATGCCGGAACTAAACCGGGAAAGAAATCACTC
CTTGCATTGTGGGAGTCTTTCTACAATGACAAGAACCTAGGTGGATCTTGCGGTGAGATTCACGCAATGTTAGGA
CAAGGTTGGAAAAACTTGATGAACCCCCTCGTCGCCGCACAAAACTTCGAGTACAAGATCTCCAATATTCTTGAC
AAACCGCTAGAGAGTGCCTTCGGGTACGTTAGTGTGTTACCGGGTGCCTTCTCCGCGTACCGCTATCGCGCTATT
ATGGGTCGCCCGCTAGAGCAGTACTTCCACGGCGATCATACACTCTCAAAGCAGTTGGGTAAGAAGGGTATTGAG
GGCATGAATATCTTTAAAAAGAATATGTTCCTCGCCGAGGACCGTATCTTATGTTTCGAGCTTGTGGCAAAGGCT
GGATTTAAATGGCATCTAACCTACGTGAAGGCGTCAAAGGGCGAGACTGATGTGCCGGAGGGTGCAGCCGAGTTT
ATCAGTCAGCGACGTCGTTGGTTGAACGGTTCGTTCGCCGCCAGTTTGTACGCAATGATGCATTTTGGAAGGATT
TATAAGAGTGGCCACAACCTCCTACGGCTGTTCTTCCTACATATCCAAATGACATACAACTTCATGGGTCTTGTC
ATGACCTGGTTCTCTCTCGCCTCGTTCTGGCTGACTACTACTGTCATCATGGATCTTGTCGGAACTCCTAGTGAG
TCCAACAAGAATAGGGGATGGCCGTTCGGTAACGAAGCGACGCCAATCGTGAACAACTTCCTCAAGTACGGATAC
ATCTTCTTCTTGATGCTCCAGTTCATCCTAGCGCTAGGAAATCGACCGAAAGGTTCACGTCTCGCATACACGCTT
TCGTTCATGTATTTCAGTATCGTTCAAACTTACATCATGGTCCTATCATTCTACCTTGTCAAGAATGCTTTCACT
GGAGGCACGCTTGATTTCTCTATGGACCGAGGTGTTTCCCACTTCCTAAAGTCTTTCTTCGGTTCGTCCGGGGCC
GGTATCGTCCTGATCGCTTTGGTTTCGACTTATGGTATTTACTTCATCGCAAGTTTCTTGTACATGGATCCCTGG
CATATGTTCACGTCCTCCTGGGCGTACTTTGCCGGTATGACATGTTCGATCAATATCCTGATGGTCTACGCTTTC
TGCAACTGGCATGACGTTTCCTGGGGTACCAAGGGTTCTGACAAGGGCGATTCGCTCCCCGTCGCTGAGACGAAG
AAAGACGACGCCAAGTCAAACTTCATTGAAGAAGTCGATAAGCCACAGGCCGATATCGACAGTCAGTTCGAATCG
ACGGTCAAGAGAGCACTAGAGCCATATGTTGAGCCTGAAGATAATGACGAACCAAGCATGGATGATGGCTATAAG
GCTTTCCGAACCAACCTGGTGTTGATTTGGATTTTCAGCAACCTGATCCTTGCACTGTGTATCACCAGTGAAGGC
ATCACCCGTCTCTGTCTCACGAACACTTCTACCCTTCGTACCTCCAAGTATTTCGCCGCTATTCTGTGGACGACC
GCCGGTCTGTCGATTTTCCGCTTTATTGGATCCCTCTGGTTCCTGGGCAAGTCTGGTATCTTGTGCTGTGTTTCT
CGCCGTTAA
Transcript >Pro_DTO377G3_2|g5170.t1
ATGTCTTTTCCTCAGAGGAGCACATCGCCTCACTCGCCTCACTCAGGCGACCTATCTCATTCTCCCCAAGCCAGC
GAGACTAGCGTGTATGGTCCACGAGAGCAAGCGTACGGTTACGAGGAGAAACCCGAGAACCTCGACAGCCAGCAG
TCTTTGCTTTACCGAAACCAGCCTAGCCCTTTCAACGCTTCATTCGATGACCCATATGCCTCGACCGATTCCCTC
CGTCGCTACACACTACAGGACCCCGGAGTCACCATCTTCCCCGATGGTCCATACCAGGAGTCCGCAGGAGGACTC
AACAGCCGTCGTTCGGGTATTCAATCACCCATGTCTGAGACTCCGTCGGAAGCTTGGCAAAACCGACAGGCACCT
GTGTCAGGGCTGCGGCGTTATGCTACGCGAAAGATCAAGTTGGTCCAGGGCTCTGTGCTCAGTGTCGACTATCCA
GTTCCAAGCGCCATCCAGAATGCGATACAGAAGGAGTATCGGGAATCGGAGGAGGGCTTCCCGGAAGAATTCACG
CATCTGCGTTATACCGCGGCCACCTGTGATCCTGACGAGTTCACCCTACGAAACGGATACAATCTGCGACCGGCT
ATGTACAACCGACACACTGAGCTTTTGATCGCTATCACATATTACAACGAAGATAAAGTTCTGACCGCGCGGACG
CTCCACGGTGTCATGCAGAACATTCGAGATATCGTCAATTTGAAGAAGTCGGAATTCTGGAATAAGGGTGGCCCG
GCCTGGCAAAAGATTGTGTGCTCCTTGGTTTTTGATGGTATTGATCCTTGCGACAAAAATACACTCGACTTATTG
GCCACTGTTGGTATCTACCAAGATGGCATCATGAAGCGCTCCGTCGATGGTCGGGAAACCGTCGCACACATCTTC
GAATATACCACCCAACTCTCAGTTACACCAAGCCAACAGTTGATCCGGCCCCAGGGCAACGAGTCATCAAACCTT
CCTCCCGTTCAAATGATTTTCTGTCTGAAGCAGAAGAACAGTAAAAAGATTAACTCCCACCGCTGGCTCTTTAAC
GGTTTCAGCCGAATCCTTAACCCCGAAGTCGTGATTCTCATTGATGCCGGAACTAAACCGGGAAAGAAATCACTC
CTTGCATTGTGGGAGTCTTTCTACAATGACAAGAACCTAGGTGGATCTTGCGGTGAGATTCACGCAATGTTAGGA
CAAGGTTGGAAAAACTTGATGAACCCCCTCGTCGCCGCACAAAACTTCGAGTACAAGATCTCCAATATTCTTGAC
AAACCGCTAGAGAGTGCCTTCGGGTACGTTAGTGTGTTACCGGGTGCCTTCTCCGCGTACCGCTATCGCGCTATT
ATGGGTCGCCCGCTAGAGCAGTACTTCCACGGCGATCATACACTCTCAAAGCAGTTGGGTAAGAAGGGTATTGAG
GGCATGAATATCTTTAAAAAGAATATGTTCCTCGCCGAGGACCGTATCTTATGTTTCGAGCTTGTGGCAAAGGCT
GGATTTAAATGGCATCTAACCTACGTGAAGGCGTCAAAGGGCGAGACTGATGTGCCGGAGGGTGCAGCCGAGTTT
ATCAGTCAGCGACGTCGTTGGTTGAACGGTTCGTTCGCCGCCAGTTTGTACGCAATGATGCATTTTGGAAGGATT
TATAAGAGTGGCCACAACCTCCTACGGCTGTTCTTCCTACATATCCAAATGACATACAACTTCATGGGTCTTGTC
ATGACCTGGTTCTCTCTCGCCTCGTTCTGGCTGACTACTACTGTCATCATGGATCTTGTCGGAACTCCTAGTGAG
TCCAACAAGAATAGGGGATGGCCGTTCGGTAACGAAGCGACGCCAATCGTGAACAACTTCCTCAAGTACGGATAC
ATCTTCTTCTTGATGCTCCAGTTCATCCTAGCGCTAGGAAATCGACCGAAAGGTTCACGTCTCGCATACACGCTT
TCGTTCATGTATTTCAGTATCGTTCAAACTTACATCATGGTCCTATCATTCTACCTTGTCAAGAATGCTTTCACT
GGAGGCACGCTTGATTTCTCTATGGACCGAGGTGTTTCCCACTTCCTAAAGTCTTTCTTCGGTTCGTCCGGGGCC
GGTATCGTCCTGATCGCTTTGGTTTCGACTTATGGTATTTACTTCATCGCAAGTTTCTTGTACATGGATCCCTGG
CATATGTTCACGTCCTCCTGGGCGTACTTTGCCGGTATGACATGTTCGATCAATATCCTGATGGTCTACGCTTTC
TGCAACTGGCATGACGTTTCCTGGGGTACCAAGGGTTCTGACAAGGGCGATTCGCTCCCCGTCGCTGAGACGAAG
AAAGACGACGCCAAGTCAAACTTCATTGAAGAAGTCGATAAGCCACAGGCCGATATCGACAGTCAGTTCGAATCG
ACGGTCAAGAGAGCACTAGAGCCATATGTTGAGCCTGAAGATAATGACGAACCAAGCATGGATGATGGCTATAAG
GCTTTCCGAACCAACCTGGTGTTGATTTGGATTTTCAGCAACCTGATCCTTGCACTGTGTATCACCAGTGAAGGC
ATCACCCGTCTCTGTCTCACGAACACTTCTACCCTTCGTACCTCCAAGTATTTCGCCGCTATTCTGTGGACGACC
GCCGGTCTGTCGATTTTCCGCTTTATTGGATCCCTCTGGTTCCTGGGCAAGTCTGGTATCTTGTGCTGTGTTTCT
CGCCGTTAA
Gene >Pro_DTO377G3_2|g5170.t1
ATGTCTTTTCCTCAGAGGAGCACATCGCCTCACTCGCCTCACTCAGGCGACCTATCTCATTCTCCCCAAGCCAGC
GAGACTAGCGTGTATGGTCCACGAGAGGTGAGTGACCAGCGACTCGGAACAAAAAAAAAAACAAACAAACAGAGG
AGACCGACCAAGACAGCAGTGGATGCTAATTCAGTTTGTTCCACAGCAAGCGTACGGTTACGAGGAGAAACCCGA
GAACCTCGACAGCCAGCAGTCTTTGCTTTACCGAAACCAGCCTAGCCCTTTCAACGCTTCATTCGATGACCCATA
TGCCTCGACCGATTCCCTCCGTCGCTACACACTACAGGACCCCGGAGTCACCATCTTCCCCGATGGTCCATACCA
GGAGTCCGCAGGAGGACTCAACAGCCGTCGTTCGGGTATTCAATCACCCATGTCTGAGACTCCGTCGGAAGCTTG
GCAAAACCGACAGGCACCTGTGTCAGGGCTGCGGCGTTATGCTACGCGAAAGATCAAGTTGGTCCAGGGCTCTGT
GCTCAGTGTCGACTATCCAGTTCCAAGCGCCATCCAGAATGCGATACAGAAGGAGTATCGGGAATCGGAGGAGGG
CTTCCCGGAAGAATTCACGCATCTGCGTTGTAAGTCTTCGTGTCAAATATTGATCATGCGACTCGAGCTGATCGC
ACACAGATACCGCGGCCACCTGTGATCCTGACGAGTTCACCCTACGAAACGGATACAATCTGCGACCGGCTATGT
ACAACCGACACACTGAGCTTTTGATCGCTATCACATATTACAACGAAGATAAAGTTCTGACCGCGCGGACGCTCC
ACGGTGTCATGCAGAACATTCGAGATATCGTCAATTTGAAGAAGTCGGAATTCTGGAATAAGGGTGGCCCGGCCT
GGCAAAAGATTGTGTGCTCCTTGGTTTTTGATGGTATTGATCCTTGCGACAAAAATACACTCGACTTATTGGCCA
CTGTTGGTATCTACCAAGATGGCATCATGAAGCGCTCCGTCGATGGTCGGGAAACCGTCGCACACATCGTGAGTT
CTTATAGTCTTGATTCACCTTGGCAAAGTCTACCCTCTTTCCCGGTGTCTTTGTGGCCGACGAAAATCCACTAAC
AAGATCAAGTTCGAATATACCACCCAACTCTCAGTTACACCAAGCCAACAGTTGATCCGGCCCCAGGGCAACGAG
TCATCAAACCTTCCTCCCGTTCAAATGATTTTCTGTCTGAAGCAGAAGAACAGTAAAAAGATTAACTCCCACCGC
TGGCTCTTTAACGGTTTCAGCCGAATCCTTAACCCCGAAGTCGTGATTCTCATTGATGCCGGAACTAAACCGGGA
AAGAAATCACTCCTTGCATTGTGGGAGTCTTTCTACAATGACAAGAACCTAGGTGGATCTTGCGGTGAGATTCAC
GCAATGTTAGGACAAGGTTGGAAAAACTTGATGAACCCCCTCGTCGCCGCACAAAACTTCGAGTACAAGATCTCC
AATATTCTTGACAAACCGCTAGAGAGTGCCTTCGGGTACGTTAGTGTGTTACCGGGTGCCTTCTCCGCGTACCGC
TATCGCGCTATTATGGGTCGCCCGCTAGAGCAGTACTTCCACGGCGATCATACACTCTCAAAGCAGTTGGGTAAG
AAGGGTATTGAGGGCATGAATATCTTTAAAAAGAATATGTTCCTCGCCGAGGACCGTATCTTATGTTTCGAGCTT
GTGGCAAAGGCTGGATTTAAATGGCATCTAACCTACGTGAAGGCGTCAAAGGGCGAGACTGATGTGCCGGAGGGT
GCAGCCGAGTTTATCAGTCAGCGACGTCGTTGGTTGAACGGTTCGTTCGCCGCCAGTTTGTACGCAATGATGCAT
TTTGGAAGGATTTATAAGAGTGGCCACAACCTCCTACGGCTGTTCTTCCTACATATCCAAATGACATACAACTTC
ATGGGTCTTGTCATGACCTGGTTCTCTCTCGGTATGTCTCGGATCTCGTGTTCTTTGGTGAATCTCATACTAACT
CGTACTAGCCTCGTTCTGGCTGACTACTACTGTCATCATGGATCTTGTCGGAACTCCTAGTGAGTCCAACAAGAA
TAGGGGATGGCCGTTCGGTAACGAAGCGACGCCAATCGTGAACAACTTCCTCAAGTACGGATACATCTTCTTCTT
GATGCTCCAGTTCATCCTAGCGCTAGGAAATCGACCGAAAGGGTAAGCTAAAATCTGAAAAAAATCACCCCATCA
TGTCAAACTGACATTTGAAACAGTTCACGTCTCGCATACACGCTTTCGTTCATGTATTTCAGTATCGTTCAAACT
TACATCATGGTCCTATCATTCTACCTTGTCAAGAATGCTTTCACTGGAGGCACGCTTGATTTCTCTATGGACCGA
GGTGTTTCCCACTTCCTAAAGTCTTTCTTCGGTTCGTCCGGGGCCGGTATCGTCCTGATCGCTTTGGTTTCGACT
TATGGTATTTACTTCATCGCAAGTTTCTTGTACATGGATCCCTGGCATATGTTCACGTCCTCCTGGGCGTACTTT
GCCGGTATGACATGTTCGATCAATATCCTGATGGTCTACGCTTTCTGCAACTGGCATGACGTTTCCTGGGGTACC
AAGGGTTCTGACAAGGGCGATTCGCTCCCCGTCGCTGAGACGAAGAAAGACGACGCCAAGTCAAACTTCATTGAA
GAAGTCGATAAGCCACAGGCCGATATCGACAGTCAGTTCGAATCGACGGTCAAGAGAGCACTAGAGCCATATGTT
GAGCCTGAAGATAATGACGAACCAAGCATGGATGATGGCTATAAGGCTTTCCGAACCAACCTGGTGTTGATTTGG
ATTTTCAGCAACCTGATCCTTGCACTGTGTATCACCAGTGAAGGCATCACCCGTCTCTGTCTCACGGTATGTATC
TTGTCTAACTCCAGGCTGTGGCATAAACTAACATTCAAAGAACACTTCTACCCTTCGTACCTCCAAGTATTTCGC
CGCTATTCTGTGGACGACCGCCGGTCTGTCGATTTTCCGCTTTATTGGATCCCTCTGGTTCCTGGGCAAGTCTGG
TATCTTGTGCTGTGTTTCTCGCCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail