Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5167.t1
Gene name
Locationscaffold_12:79292..80788
Strand-
Gene length (bp)1496
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.3E-47 58 455

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 88 110 22
3 141 163 22
4 173 195 22
5 202 224 22
6 244 263 19
7 283 305 22
8 325 347 22
9 368 390 22
10 395 417 22
11 430 452 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5167.t1
MGFENISNDHDTDKVMETEGEKAAYAPPPPFEGDMVGEMSEAERNLYDHGINKFNRLGWKRLTVVLIVEAIALGS
LSVPSTFATLGMVAGVICCVGIGLIAIYTSYIVGMVKLAFPEVANYADAGRLLGHRLGCGRFAYELVNAMLGLQL
IFLTASHCLTGTIAFLDITKSGICSIIFAVVSAVILLLLAIPPSFTEVAILGYVDFVSIIAAIGITIIGTGVQAT
NSPGGLSGVAWSAWPKDNISFTEAFIAVTNIIFAYSFAMCQFSFMDEMHTPRDFIKSIWTLGITEIVIYTITGAT
IYAFVGQDVSSPALTSAGTTLSRIAYGIALPVIFISGSINTVVFGRVVHGRIFANSPIRFINTKMGWLTWLAVIT
AATVVAFIIAEVIPFFNDLLSISSALFISGFTFYFPAMMWFMLLRKGSWKEPKNLILAVINALIFLIGMVVLAGG
TYSSIDDIIIKYAKGEVRGVFSCGAPE*
Coding >Pro_DTO377G3_2|g5167.t1
ATGGGCTTCGAAAACATCTCTAACGACCATGACACCGACAAGGTGATGGAAACGGAAGGCGAGAAGGCCGCATAT
GCTCCCCCACCGCCGTTTGAGGGGGACATGGTCGGGGAAATGAGCGAGGCTGAGAGGAACCTGTATGACCACGGT
ATCAACAAGTTCAATCGTCTCGGTTGGAAGCGACTCACTGTCGTCCTCATCGTCGAGGCGATTGCACTCGGTAGT
TTGTCGGTTCCCTCCACCTTTGCAACACTCGGCATGGTCGCCGGTGTGATCTGCTGTGTGGGCATCGGTCTCATC
GCCATCTATACCAGTTACATTGTCGGAATGGTCAAATTGGCCTTCCCCGAGGTTGCCAACTATGCTGATGCGGGT
CGATTGCTGGGCCATCGGCTAGGGTGTGGTCGCTTTGCATATGAGCTAGTCAATGCGATGCTCGGTCTTCAACTT
ATCTTTCTCACGGCCTCGCACTGTCTGACGGGAACCATCGCATTCCTCGACATCACCAAAAGCGGCATTTGCTCG
ATCATCTTTGCCGTGGTTTCTGCCGTCATCCTGCTCCTACTCGCCATTCCGCCTAGTTTCACCGAGGTGGCAATT
CTAGGCTATGTTGATTTCGTATCCATCATCGCTGCCATTGGAATCACAATTATCGGGACGGGTGTGCAGGCGACG
AACTCGCCCGGTGGACTCTCCGGAGTAGCATGGTCTGCGTGGCCGAAGGATAACATCTCCTTTACTGAAGCCTTC
ATCGCTGTGACGAACATAATTTTCGCCTACAGTTTTGCCATGTGCCAATTCTCCTTTATGGACGAAATGCACACT
CCTCGAGACTTTATTAAGTCGATCTGGACGCTGGGTATCACTGAGATCGTCATCTACACCATCACTGGTGCTACA
ATCTACGCCTTTGTTGGCCAGGATGTGTCCAGCCCTGCACTTACCTCTGCCGGAACTACCCTCAGCCGCATTGCG
TATGGCATTGCTCTCCCTGTGATCTTCATTAGCGGTTCGATCAACACCGTGGTATTTGGGCGTGTGGTGCATGGT
CGCATCTTCGCCAACTCCCCCATTCGCTTCATCAACACTAAGATGGGCTGGCTGACATGGCTGGCGGTGATCACG
GCCGCCACAGTTGTGGCATTCATCATTGCCGAGGTGATACCTTTTTTCAACGACTTGCTTTCAATTTCTTCTGCT
CTTTTTATCTCCGGATTCACCTTCTACTTCCCTGCCATGATGTGGTTCATGCTCCTTCGGAAAGGGAGTTGGAAA
GAGCCCAAGAACTTGATACTGGCAGTCATCAATGCGCTGATTTTCCTGATCGGTATGGTGGTACTTGCTGGAGGA
ACATATTCCAGCATTGATGATATCATAATCAAGTACGCCAAAGGAGAAGTTCGTGGCGTCTTTTCGTGCGGTGCT
CCCGAGTAA
Transcript >Pro_DTO377G3_2|g5167.t1
ATGGGCTTCGAAAACATCTCTAACGACCATGACACCGACAAGGTGATGGAAACGGAAGGCGAGAAGGCCGCATAT
GCTCCCCCACCGCCGTTTGAGGGGGACATGGTCGGGGAAATGAGCGAGGCTGAGAGGAACCTGTATGACCACGGT
ATCAACAAGTTCAATCGTCTCGGTTGGAAGCGACTCACTGTCGTCCTCATCGTCGAGGCGATTGCACTCGGTAGT
TTGTCGGTTCCCTCCACCTTTGCAACACTCGGCATGGTCGCCGGTGTGATCTGCTGTGTGGGCATCGGTCTCATC
GCCATCTATACCAGTTACATTGTCGGAATGGTCAAATTGGCCTTCCCCGAGGTTGCCAACTATGCTGATGCGGGT
CGATTGCTGGGCCATCGGCTAGGGTGTGGTCGCTTTGCATATGAGCTAGTCAATGCGATGCTCGGTCTTCAACTT
ATCTTTCTCACGGCCTCGCACTGTCTGACGGGAACCATCGCATTCCTCGACATCACCAAAAGCGGCATTTGCTCG
ATCATCTTTGCCGTGGTTTCTGCCGTCATCCTGCTCCTACTCGCCATTCCGCCTAGTTTCACCGAGGTGGCAATT
CTAGGCTATGTTGATTTCGTATCCATCATCGCTGCCATTGGAATCACAATTATCGGGACGGGTGTGCAGGCGACG
AACTCGCCCGGTGGACTCTCCGGAGTAGCATGGTCTGCGTGGCCGAAGGATAACATCTCCTTTACTGAAGCCTTC
ATCGCTGTGACGAACATAATTTTCGCCTACAGTTTTGCCATGTGCCAATTCTCCTTTATGGACGAAATGCACACT
CCTCGAGACTTTATTAAGTCGATCTGGACGCTGGGTATCACTGAGATCGTCATCTACACCATCACTGGTGCTACA
ATCTACGCCTTTGTTGGCCAGGATGTGTCCAGCCCTGCACTTACCTCTGCCGGAACTACCCTCAGCCGCATTGCG
TATGGCATTGCTCTCCCTGTGATCTTCATTAGCGGTTCGATCAACACCGTGGTATTTGGGCGTGTGGTGCATGGT
CGCATCTTCGCCAACTCCCCCATTCGCTTCATCAACACTAAGATGGGCTGGCTGACATGGCTGGCGGTGATCACG
GCCGCCACAGTTGTGGCATTCATCATTGCCGAGGTGATACCTTTTTTCAACGACTTGCTTTCAATTTCTTCTGCT
CTTTTTATCTCCGGATTCACCTTCTACTTCCCTGCCATGATGTGGTTCATGCTCCTTCGGAAAGGGAGTTGGAAA
GAGCCCAAGAACTTGATACTGGCAGTCATCAATGCGCTGATTTTCCTGATCGGTATGGTGGTACTTGCTGGAGGA
ACATATTCCAGCATTGATGATATCATAATCAAGTACGCCAAAGGAGAAGTTCGTGGCGTCTTTTCGTGCGGTGCT
CCCGAGTAA
Gene >Pro_DTO377G3_2|g5167.t1
ATGGGCTTCGAAAACATCTCTAACGACCATGACACCGACAAGGTGATGGAAACGGAAGGCGAGAAGGCCGCATAT
GCTCCCCCACCGCCGTTTGAGGGGGACATGGTCGGGGAAATGAGCGAGGCTGAGAGGAACCTGTATGACCACGGT
ATCAACAAGTTCAATCGTCTCGGTTGGAAGCGACTCACTGTCGTCCTCATCGTCGAGGCGATTGCACTCGGTAGT
TTGTCGGTTCCCTCCACCTTTGCAACACTCGGCATGGTCGCCGGTGTGATCTGCTGTGTGGGCATCGGTCTCATC
GCCATCTATACCAGTTACATTGTCGGAATGGTCAAATTGGCCTTCCCCGAGGTTGCCAACTATGCTGATGCGGGT
CGATTGCTGGGCCATCGGCTAGGGTGTGGTCGCTTTGCATATGAGCTAGTCAATGCGATGCTCGGTCTTCAACTT
ATCTTTCTCACGGCCTCGCACTGTCTGACGGGAACCATCGCATTCCTCGACATCACCAAAAGCGGCATTTGCTCG
ATCATCTTTGCCGTGGTTTCTGCCGTCATCCTGCTCCTACTCGCCATTCCGCCTAGTTTCACCGAGGTGGCAATT
CTAGGCTATGTTGATTTCGTATCCATCATCGCTGCCATTGGAATCACAATTATCGGGACGGGTGTGCAGGCGACG
AACTCGCCCGGTGGACTCTCCGGAGTAGCATGGTCTGCGTGGCCGAAGGATAACATCTCCTTTACTGAAGCCTTC
ATCGCTGTGACGAACATAATTTTCGCCTACAGTTTTGCCATGTGCCAATTCTCCTTTATGGACGAAATGCACACT
CCTCGAGACTTTATTAAGTCGATCTGGACGCTGGGTATCACTGAGATCGTCATCTACACCATCACTGGTGCTACA
ATCTACGCCTTTGTTGGCCAGGATGTGTCCAGCCCTGCACTTACCTCTGCCGGAACTACCCTCAGCCGCATTGCG
TATGGCATTGCTCTCCCTGTGATCTTCATTAGCGGTTCGATCAACACCGTGGTATTTGGGCGTGTGGTGCATGGT
CGCATCTTCGCCAACTCCCCCATTCGCTTCATCAACACTAAGATGGGCTGGCTGACATGGCTGGCGGTGATCACG
GCCGCCACAGTTGTGGCATTCATCATTGCCGAGGTGATACCTTTTTTCAACGACTTGCTTTCAATTTCTTCTGCT
CTTTTTATCTCCGGATTCACCTTCTACTTCCCTGCCATGATGTGGTTCATGCTCCTTCGGAAAGGGAGTTGGAAA
GAGCCCAAGAACTTGATACTGGCAGTCATCAATGCGCTGATTTTCCTGATCGGTATGGTGGTACTTGCTGGAGGA
ACATATTCCAGCATTGATGATATCGTAAGTTTTTCTCTGGCGGTCTGCCTTGGGGCACGGATTTTATTACTAACT
CACTCATCTAGATAATCAAGTACGCCAAAGGAGAAGTTCGTGGCGTCTTTTCGTGCGGTGCTCCCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail