Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5164.t1
Gene name
Locationscaffold_12:73162..75217
Strand-
Gene length (bp)2055
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 502 524 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.38 0.00 0.81
5d_25C Five days - 25 degrees Celsius 0.87 0.08 1.66
7d_25C Seven days - 25 degrees Celsius 0.88 0.06 1.70
10d_25C Ten days - 25 degrees Celsius 0.73 0.01 1.45
7d_15C Seven days - 15 degrees Celsius 0.56 0.00 1.14
7d_30C Seven days - 30 degrees Celsius 1.24 0.16 2.32

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.158622 no
3d_25C 7d_25C 0.162590 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.033253 yes
3d_25C 10d_25C 0.311648 no
5d_25C 7d_25C 0.982832 no
5d_25C 7d_15C 0.487578 no
5d_25C 7d_30C 0.548877 no
5d_25C 10d_25C 0.810833 no
7d_25C 7d_15C 0.486244 no
7d_25C 7d_30C 0.588758 no
7d_25C 10d_25C 0.794245 no
7d_15C 7d_30C 0.149767 no
7d_15C 10d_25C 0.719056 no
7d_30C 10d_25C 0.356231 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5164.t1
MSGSDDCDSRMRGLQQCVFTIWILCLDKVLCSGPREMTWSDKKFGPDGPWQAVTVSIGSNYSELVVPSSVVALYP
GGSWESKILLPSICDNKSLSSVCYGDKAGLFDSDVSVTLDDNSISLPPYGTWGYVDWGCTDAVPVYAKARRGTDW
ITIDGAHVPDVDLITISAGWQTYPGGQAYPLQVGTLSLGSPDINQTFGASIKINATFITSYLYEQEGSTKIPSYS
YGMHIGSASLGIPGSLHLGGYDQNRVIGTVSAQSFSSGSFPIEMYDMSIGVAEGGSPWNYSNKTGLLAKGNSSLD
AGLKIVVDPVNPYIYLPRSSCDAIAAELPVIYQPDYGLYFWNTSDAQYDKVVTSPSYLAFTFSMNSRNNEEITIR
VPFALLNLTLEPPLVKTPTQYFPCMATNSTPALGRAFLQAAFVGVNWLGGKWFLAQAPGPDGSFIVNTVTIGDNE
STISGSSNSWKNTWKNTWNLIPTNSNLKPTKTDTETSSSTTSSNGLSTAVKIGIIVGCTVGGVLMIAICCGLCIR
HRRQKEKSLNRDQNSAAHGRFDQWPSAHQSTLVEAADNKWNRLNELHHSHQLYEMRSERGPFYEMGPEKGSIVAI
GHKKVVQHGPFELPERTSVLGSSKFI*
Coding >Pro_DTO377G3_2|g5164.t1
ATGAGTGGCAGTGACGACTGTGATTCAAGAATGAGAGGACTACAACAATGTGTTTTCACAATTTGGATCCTTTGC
CTCGATAAGGTCCTCTGTTCTGGTCCCCGGGAGATGACCTGGTCTGATAAAAAGTTCGGACCTGATGGCCCTTGG
CAAGCGGTCACGGTGTCTATCGGAAGCAACTACTCTGAACTTGTTGTGCCTTCATCGGTAGTGGCGTTGTACCCG
GGAGGTAGTTGGGAAAGTAAAATCCTACTACCTTCCATATGTGACAACAAGTCCCTCTCGTCGGTATGCTATGGG
GATAAAGCGGGTCTTTTTGACAGCGACGTATCAGTCACCTTGGACGATAACTCAATTTCACTACCTCCATATGGA
ACATGGGGTTATGTGGACTGGGGATGTACGGACGCAGTTCCAGTTTATGCCAAAGCACGACGAGGAACAGATTGG
ATAACCATTGACGGTGCTCACGTTCCTGATGTCGACTTGATTACCATATCTGCTGGATGGCAGACTTACCCTGGT
GGACAAGCATACCCTTTACAGGTTGGAACCCTTTCTCTTGGGAGTCCAGATATTAATCAGACATTTGGGGCTTCG
ATCAAAATCAACGCGACCTTCATCACCAGCTACCTCTACGAGCAGGAGGGGTCCACGAAAATACCATCATATTCC
TATGGAATGCATATTGGCTCCGCATCTCTGGGAATCCCTGGCTCACTTCATCTGGGAGGCTATGATCAGAATAGG
GTCATTGGAACCGTGTCCGCTCAGTCGTTTTCAAGTGGAAGCTTCCCGATCGAAATGTACGATATGAGTATTGGA
GTGGCAGAAGGCGGATCGCCTTGGAATTACTCCAACAAAACAGGTCTCTTGGCAAAGGGCAATTCCTCCCTGGAT
GCCGGTCTCAAGATTGTTGTGGACCCAGTCAATCCATACATATATCTGCCTCGAAGCTCATGTGATGCGATAGCC
GCTGAGTTGCCCGTCATATACCAACCTGATTATGGCCTCTATTTTTGGAACACGTCCGACGCGCAGTACGACAAA
GTTGTGACCTCTCCAAGTTATTTGGCATTCACGTTTAGTATGAATAGCCGCAATAACGAAGAAATCACGATCAGG
GTCCCCTTCGCTCTCCTAAATCTCACACTAGAGCCCCCGCTTGTGAAGACGCCGACGCAATACTTCCCATGCATG
GCCACCAACAGCACCCCTGCTCTAGGCCGTGCTTTTCTCCAAGCAGCCTTTGTCGGCGTTAATTGGCTTGGTGGG
AAGTGGTTTTTGGCCCAAGCACCAGGACCTGATGGCTCTTTTATTGTCAATACAGTGACAATAGGGGACAATGAA
TCCACCATTTCGGGGTCTTCCAATAGTTGGAAAAACACCTGGAAGAACACCTGGAATTTGATTCCTACAAATTCG
AACTTGAAACCGACCAAGACGGATACCGAAACAAGCAGCTCAACTACTAGCAGCAATGGTCTCTCCACAGCTGTC
AAGATTGGCATCATCGTTGGTTGTACTGTAGGCGGGGTGTTGATGATTGCCATTTGTTGTGGGCTCTGCATTCGC
CACCGTCGACAGAAGGAGAAATCACTCAATCGGGATCAGAATAGTGCAGCCCACGGGCGATTTGACCAATGGCCT
TCAGCGCATCAGTCGACGCTTGTGGAAGCTGCCGATAATAAATGGAACCGACTAAATGAATTGCACCACAGCCAC
CAATTATACGAGATGCGCTCGGAGAGAGGTCCTTTTTATGAGATGGGCCCAGAGAAAGGTTCTATAGTTGCAATC
GGCCATAAAAAGGTAGTTCAGCATGGCCCCTTCGAGTTGCCAGAGCGAACGTCCGTCTTGGGGTCTTCTAAATTT
ATCTGA
Transcript >Pro_DTO377G3_2|g5164.t1
ATGAGTGGCAGTGACGACTGTGATTCAAGAATGAGAGGACTACAACAATGTGTTTTCACAATTTGGATCCTTTGC
CTCGATAAGGTCCTCTGTTCTGGTCCCCGGGAGATGACCTGGTCTGATAAAAAGTTCGGACCTGATGGCCCTTGG
CAAGCGGTCACGGTGTCTATCGGAAGCAACTACTCTGAACTTGTTGTGCCTTCATCGGTAGTGGCGTTGTACCCG
GGAGGTAGTTGGGAAAGTAAAATCCTACTACCTTCCATATGTGACAACAAGTCCCTCTCGTCGGTATGCTATGGG
GATAAAGCGGGTCTTTTTGACAGCGACGTATCAGTCACCTTGGACGATAACTCAATTTCACTACCTCCATATGGA
ACATGGGGTTATGTGGACTGGGGATGTACGGACGCAGTTCCAGTTTATGCCAAAGCACGACGAGGAACAGATTGG
ATAACCATTGACGGTGCTCACGTTCCTGATGTCGACTTGATTACCATATCTGCTGGATGGCAGACTTACCCTGGT
GGACAAGCATACCCTTTACAGGTTGGAACCCTTTCTCTTGGGAGTCCAGATATTAATCAGACATTTGGGGCTTCG
ATCAAAATCAACGCGACCTTCATCACCAGCTACCTCTACGAGCAGGAGGGGTCCACGAAAATACCATCATATTCC
TATGGAATGCATATTGGCTCCGCATCTCTGGGAATCCCTGGCTCACTTCATCTGGGAGGCTATGATCAGAATAGG
GTCATTGGAACCGTGTCCGCTCAGTCGTTTTCAAGTGGAAGCTTCCCGATCGAAATGTACGATATGAGTATTGGA
GTGGCAGAAGGCGGATCGCCTTGGAATTACTCCAACAAAACAGGTCTCTTGGCAAAGGGCAATTCCTCCCTGGAT
GCCGGTCTCAAGATTGTTGTGGACCCAGTCAATCCATACATATATCTGCCTCGAAGCTCATGTGATGCGATAGCC
GCTGAGTTGCCCGTCATATACCAACCTGATTATGGCCTCTATTTTTGGAACACGTCCGACGCGCAGTACGACAAA
GTTGTGACCTCTCCAAGTTATTTGGCATTCACGTTTAGTATGAATAGCCGCAATAACGAAGAAATCACGATCAGG
GTCCCCTTCGCTCTCCTAAATCTCACACTAGAGCCCCCGCTTGTGAAGACGCCGACGCAATACTTCCCATGCATG
GCCACCAACAGCACCCCTGCTCTAGGCCGTGCTTTTCTCCAAGCAGCCTTTGTCGGCGTTAATTGGCTTGGTGGG
AAGTGGTTTTTGGCCCAAGCACCAGGACCTGATGGCTCTTTTATTGTCAATACAGTGACAATAGGGGACAATGAA
TCCACCATTTCGGGGTCTTCCAATAGTTGGAAAAACACCTGGAAGAACACCTGGAATTTGATTCCTACAAATTCG
AACTTGAAACCGACCAAGACGGATACCGAAACAAGCAGCTCAACTACTAGCAGCAATGGTCTCTCCACAGCTGTC
AAGATTGGCATCATCGTTGGTTGTACTGTAGGCGGGGTGTTGATGATTGCCATTTGTTGTGGGCTCTGCATTCGC
CACCGTCGACAGAAGGAGAAATCACTCAATCGGGATCAGAATAGTGCAGCCCACGGGCGATTTGACCAATGGCCT
TCAGCGCATCAGTCGACGCTTGTGGAAGCTGCCGATAATAAATGGAACCGACTAAATGAATTGCACCACAGCCAC
CAATTATACGAGATGCGCTCGGAGAGAGGTCCTTTTTATGAGATGGGCCCAGAGAAAGGTTCTATAGTTGCAATC
GGCCATAAAAAGGTAGTTCAGCATGGCCCCTTCGAGTTGCCAGAGCGAACGTCCGTCTTGGGGTCTTCTAAATTT
ATCTGA
Gene >Pro_DTO377G3_2|g5164.t1
ATGAGTGGCAGTGACGAGTGAATGAAGACCTATCTTCGTCTGATACTTGAAGCTTAACTTTGTGGCCTTCATTGC
TTACTGCATTGTTCAAACCGATAAATTACATCGTCACTTCAGCTGTGATTCAAGTCAGTCCTGTCTTGTAAAACA
CCGTTACTATATACTTGGGAGAAAATAATCGCTAACAATATTTCCCCCTTAGGAATGAGAGGACTACAACAATGT
GTTTTCACAATTTGGATCCTTTGCCTCGATAAGGTCCTCTGTTCTGGTCCCCGGGAGATGACCTGGTCTGATAAA
AAGTTCGGACCTGATGGCCCTTGGCAAGCGGTCACGGTGTCTATCGGAAGCAACTACTCTGAACTTGTTGTGCCT
TCATCGGTAGTGGCGTTGTACCCGGGAGGTAGTTGGGAAAGTAAAATCCTACTACCTTCCATATGTGACAACAAG
TCCCTCTCGTCGGTATGCTATGGGGATAAAGCGGGTCTTTTTGACAGCGACGTATCAGTCACCTTGGACGATAAC
TCAATTTCACTACCTCCATATGGAACATGGGGTTATGTGGACTGGGGATGTACGGACGCAGTTCCAGTTTATGCC
AAAGCACGACGAGGAACAGATTGGATAACCATTGACGGTGCTCACGTTCCTGATGTCGACTTGATTACCATATCT
GCTGGATGGCAGACTTACCCTGGTGGACAAGCATACCCTTTACAGGTTGGAACCCTTTCTCTTGGGAGTCCAGAT
ATTAATCAGACATTTGGGGCTTCGATCAAAATCAACGCGACCTTCATCACCAGCTACCTCTACGAGCAGGAGGGG
TCCACGAAAATACCATCATATTCCTATGGAATGCATATTGGCTCCGCATCTCTGGGAATCCCTGGCTCACTTCAT
CTGGGAGGCTATGATCAGAATAGGGTCATTGGAACCGTGTCCGCTCAGTCGTTTTCAAGTGGAAGCTTCCCGATC
GAAATGTACGATATGAGTATTGGAGTGGCAGAAGGCGGATCGCCTTGGAATTACTCCAACAAAACAGGTCTCTTG
GCAAAGGGCAATTCCTCCCTGGATGCCGGTCTCAAGATTGTTGTGGACCCAGTCAATCCATACATATATCTGCCT
CGAAGCTCATGTGATGCGATAGCCGCTGAGTTGCCCGTCATATACCAACCTGATTATGGCCTCTATTTTTGGAAC
ACGTCCGACGCGCAGTACGACAAAGTTGTGACCTCTCCAAGTTATTTGGCATTCACGTTTAGTATGAATAGCCGC
AATAACGAAGAAATCACGATCAGGGTCCCCTTCGCTCTCCTAAATCTCACACTAGAGCCCCCGCTTGTGAAGACG
CCGACGCAATACTTCCCATGCATGGCCACCAACAGCACCCCTGCTCTAGGCCGTGCTTTTCTCCAAGCAGCCTTT
GTCGGCGTTAATTGGCTTGGTGGGAAGTGGTTTTTGGCCCAAGCACCAGGACCTGATGGCTCTTTTATTGTCAAT
ACAGTGACAATAGGGGACAATGAATCCACCATTTCGGGGTCTTCCAATAGTTGGAAAAACACCTGGAAGAACACC
TGGAATTTGATTCCTACAAATTCGAACTTGAAACCGACCAAGACGGATACCGAAACAAGCAGCTCAACTACTAGC
AGCAATGGTCTCTCCACAGCTGTCAAGATTGGCATCATCGTTGGTTGTACTGTAGGCGGGGTGTTGATGATTGCC
ATTTGTTGTGGGCTCTGCATTCGCCACCGTCGACAGAAGGAGAAATCACTCAATCGGGATCAGAATAGTGCAGCC
CACGGGCGATTTGACCAATGGCCTTCAGCGCATCAGTCGACGCTTGTGGAAGCTGCCGATAATAAATGGAACCGA
CTAAATGAATTGCACCACAGCCACCAATTATACGAGATGCGCTCGGAGAGAGGTCCTTTTTATGAGATGGGCCCA
GAGAAAGGTTCTATAGTTGCAATCGGCCATAAAAAGGTAGTTCAGCATGGCCCCTTCGAGTTGCCAGAGCGAACG
TCCGTCTTGGGGTCTTCTAAATTTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail