Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5141.t1
Gene name
Locationscaffold_12:7330..8486
Strand+
Gene length (bp)1156
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 5.3E-06 153 178
PF12874 zf-met Zinc-finger of C2H2 type 2.0E-03 3 21
PF12874 zf-met Zinc-finger of C2H2 type 9.0E-03 66 86
PF12874 zf-met Zinc-finger of C2H2 type 7.3E-03 124 145
PF12874 zf-met Zinc-finger of C2H2 type 8.9E-04 153 176
PF13912 zf-C2H2_6 C2H2-type zinc finger 6.4E-02 4 20
PF13912 zf-C2H2_6 C2H2-type zinc finger 2.5E-02 66 85
PF13912 zf-C2H2_6 C2H2-type zinc finger 8.8E-04 153 171

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5141.t1
MAFCSSCNRSFRSETSLDQHIKDSPAHAIKFYCGLCSIWLLDIDALEEHIRTSPPHSAPTRNTSKFKCDICSTTF
VSQNFLNDHLQYSPLNATSFAHKLYSLVYLTRKELEENLQNLQAHTPNFECKSCTRLFNDQSALDRHLQSSSAHT
PTFECDPCDRSFVSQDALDAHIQSSKAHAGERHGVPLQGYRSNPTPLDIFFAYYTSFKYDPTLPPSVSYAKLVDF
YDWDRNDPEARTARREYQNSLEDEVRLWFGSESDLASWHSLCRAVGIEPLPRTCNAARVAIRNVYVNIVDLIHWA
RMGLGDRPVHRFKNIGELSQYTKLTNKFYSCRGPEKGEDNVVLRHLLRHILS*
Coding >Pro_DTO377G3_2|g5141.t1
ATGGCATTCTGTTCCTCGTGCAATCGATCGTTCAGATCCGAGACCTCCCTTGACCAACACATAAAAGACTCACCA
GCCCATGCTATAAAGTTCTACTGTGGCCTATGTTCGATCTGGCTCCTCGACATTGATGCTCTTGAAGAACACATC
CGAACCTCCCCTCCTCACAGTGCACCCACGCGCAACACATCCAAGTTCAAGTGCGATATCTGCTCGACAACTTTT
GTTAGCCAGAACTTCCTTAACGACCATCTCCAGTACTCACCTCTGAATGCCACCTCATTCGCACACAAACTTTAC
AGTTTAGTCTACCTTACACGAAAAGAATTAGAAGAAAATCTCCAGAATTTACAAGCGCATACTCCAAACTTTGAA
TGCAAATCTTGTACACGCCTCTTCAATGACCAGAGCGCTCTTGATCGGCATCTTCAGTCTTCGTCGGCTCATACC
CCAACTTTCGAATGTGATCCATGCGATCGATCATTCGTCAGTCAAGATGCGCTAGATGCACATATACAAAGCTCG
AAAGCTCACGCTGGAGAACGTCACGGTGTCCCTTTACAAGGATATCGTTCAAACCCCACACCACTAGACATCTTT
TTCGCATACTATACATCCTTCAAATACGACCCCACACTTCCACCGTCCGTATCATACGCAAAGCTCGTGGACTTC
TACGACTGGGATAGAAACGACCCGGAAGCTCGAACAGCACGCAGGGAGTATCAAAATTCACTGGAAGATGAAGTC
CGACTCTGGTTTGGGTCGGAGAGCGATCTTGCTTCCTGGCATTCTCTTTGTCGGGCTGTTGGGATTGAACCATTG
CCTAGGACTTGTAATGCTGCTAGAGTGGCTATCCGAAATGTATATGTCAATATTGTTGATTTGATTCATTGGGCT
CGTATGGGGCTGGGAGATAGGCCGGTTCACCGGTTTAAGAATATTGGGGAGCTGAGTCAATATACTAAGCTCACG
AATAAGTTCTATTCCTGTAGAGGTCCTGAAAAAGGGGAGGATAATGTTGTTCTTCGACATTTGCTTCGCCATATC
CTTTCCTAA
Transcript >Pro_DTO377G3_2|g5141.t1
ATGGCATTCTGTTCCTCGTGCAATCGATCGTTCAGATCCGAGACCTCCCTTGACCAACACATAAAAGACTCACCA
GCCCATGCTATAAAGTTCTACTGTGGCCTATGTTCGATCTGGCTCCTCGACATTGATGCTCTTGAAGAACACATC
CGAACCTCCCCTCCTCACAGTGCACCCACGCGCAACACATCCAAGTTCAAGTGCGATATCTGCTCGACAACTTTT
GTTAGCCAGAACTTCCTTAACGACCATCTCCAGTACTCACCTCTGAATGCCACCTCATTCGCACACAAACTTTAC
AGTTTAGTCTACCTTACACGAAAAGAATTAGAAGAAAATCTCCAGAATTTACAAGCGCATACTCCAAACTTTGAA
TGCAAATCTTGTACACGCCTCTTCAATGACCAGAGCGCTCTTGATCGGCATCTTCAGTCTTCGTCGGCTCATACC
CCAACTTTCGAATGTGATCCATGCGATCGATCATTCGTCAGTCAAGATGCGCTAGATGCACATATACAAAGCTCG
AAAGCTCACGCTGGAGAACGTCACGGTGTCCCTTTACAAGGATATCGTTCAAACCCCACACCACTAGACATCTTT
TTCGCATACTATACATCCTTCAAATACGACCCCACACTTCCACCGTCCGTATCATACGCAAAGCTCGTGGACTTC
TACGACTGGGATAGAAACGACCCGGAAGCTCGAACAGCACGCAGGGAGTATCAAAATTCACTGGAAGATGAAGTC
CGACTCTGGTTTGGGTCGGAGAGCGATCTTGCTTCCTGGCATTCTCTTTGTCGGGCTGTTGGGATTGAACCATTG
CCTAGGACTTGTAATGCTGCTAGAGTGGCTATCCGAAATGTATATGTCAATATTGTTGATTTGATTCATTGGGCT
CGTATGGGGCTGGGAGATAGGCCGGTTCACCGGTTTAAGAATATTGGGGAGCTGAGTCAATATACTAAGCTCACG
AATAAGTTCTATTCCTGTAGAGGTCCTGAAAAAGGGGAGGATAATGTTGTTCTTCGACATTTGCTTCGCCATATC
CTTTCCTAA
Gene >Pro_DTO377G3_2|g5141.t1
ATGGCATTCTGTTCCTCGTGCAATCGATCGTTCAGATCCGAGACCTCCCTTGACCAACACATAAAAGACTCACCA
GCCCATGCTATAAAGTTCTACTGTGGCCTATGTTCGATCTGGCTCCTCGACATTGATGCTCTTGAAGAACACATC
CGAACCTCCCCTCCTCACAGTGCACCCACGCGCAACACATCCAAGTTCAAGTGCGATATCTGCTCGACAACTTTT
GTTAGCCAGAACTTCCTTAACGACCATCTCCAGTACTCACCTCTGAATGCCACCTCATTCGCACACAAACTTTAC
AGTTTAGTCTACCTTACACGAAAAGAATTAGAAGAAAATCTCCAGAATTTACAAGCGCATACTCCAAACTTTGAA
TGCAAATCTTGTACACGCCTCTTCAATGACCAGAGCGCTCTTGATCGGCATCTTCAGTCTTCGTCGGCTCATACC
CCAACTTTCGAATGTGATCCATGCGATCGATCATTCGTCAGTCAAGATGCGCTAGATGCACATATACAAAGCTCG
AAAGCTCACGCTGGAGAACGTCACGGTGTCCCTTTACAAGGATATCGTTCAAACCCCACACCACTAGACATCTTT
TTCGCATACTATACATCCTTCAAATACGACCCCACACTTCCACCGTCCGTATCATACGCAAAGCTCGTGGACTTC
TACGACTGGGATAGAAACGACCCGGAAGCTCGAACAGCACGCAGGGAGTATCAAAATTCACTGGAAGATGAAGTC
CGACTCTGGTTTGGGTCGGAGAGCGATCTTGCTTCCTGGCATTCTCTTTGTCGGGCTGTTGGGATTGAACCATTG
CCTAGGACTTGTAATGCTGCTAGAGTGGTATGTAAAAATTATTTCCCTATCTTCTTACCTGTGGGGTTTGACTTT
ATGGAATGGGACATGGACTGGTGGCTGACGTCGTCTGCGTTCTATTTAGGCTATCCGAAATGTATATGTCAATAT
TGTTGATTTGATTCATTGGGCTCGTATGGGGCTGGGAGATAGGCCGGTTCACCGGTTTAAGAATATTGGGGAGCT
GAGTCAATATACTAAGCTCACGAATAAGTTCTATTCCTGTAGAGGTCCTGAAAAAGGGGAGGATAATGTTGTTCT
TCGACATTTGCTTCGCCATATCCTTTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail