Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5137.t1
Gene name
Locationscaffold_11:672305..675009
Strand-
Gene length (bp)2704
Transcript length (bp)2643
Coding sequence length (bp)2643
Protein length (aa) 881

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08518 GIT_SHD Spa2 homology domain (SHD) of GIT 8.8E-15 127 155
PF08518 GIT_SHD Spa2 homology domain (SHD) of GIT 1.9E-09 185 211
PF12205 GIT1_C G protein-coupled receptor kinase-interacting protein 1 C term 8.0E-09 748 865

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5137.t1
MHGGSGAMSPVSVDGSEWSGLNQYGKSDGPFSPSSRANLATPPTSGVPSVPLSPSGPPPSISPSIRSGNPSPPSS
VAARSSSGTLGDGPRDGRRYRQMEEILGQHYVVLKRFLNGTARDDRGKSNKARDKLLRLSPTQFHELSTDVYDEL
IRRQQASPPPGRPPRTDVPPYLPARSDFHEKRNHARQKLAALHHVRFRDLATDVFCELERRFPHFTSRDYRARPP
PNMGPGSARTSQQSARGPPPHMGRGYPSGGPPGSPFPPRAGSLGGPPSINGDGPFPRSFQSNTMVPNKSTMVEDS
DDMGPDDEDDARSDAFALDALSRRGTTTTLGESERRLLLESQTQVSVLQDKIEKLEELVRAKDEELAQSSQDADS
SGISHNERQEWDELRHDLESKVSKAEDLNSSLQLELERVRTEHETVERDLRSQLNDSSRGVDDAGLQARYVDLET
QHQNLQAELQQQKQVTDEVRREAAAFLTEMKTLSAESQSNWEREEQLSHEVHRLEADANEWKHRYAKVKAQLRHL
RTSSGGFADSRPDASLVAKEHELVQADGLVKDIHVTKFQVSVDELLRVARFEESHVVLQHIKMVIVTVRHILQDV
EYSSIPVDGSAALRAKVKGQVSTTANNMITATRNFASSGGLSPVSLLDAAASHLCTAIVDLIRVVKIQASPIDEL
EDEDYEVDVPQDQFPDYFGTSGSQKRMSNNSVYSAISRPDDSQYPAQNGATNDLNHGWGHVQEDHEVLELKLYVE
DQTDGMVQQIQALVASIRAEDNLQTVQTHVSAISNVVANVVSATEQLMRERSGDITLRQTSEPVIAALDQCRGRL
AATAGEGQDATTPEQLHELTNKLPPIAFEIARQIKDLVQRLEATSVATGEEDDFR*
Coding >Pro_DTO377G3_2|g5137.t1
ATGCATGGGGGTTCGGGAGCCATGTCGCCTGTCTCTGTTGATGGTAGCGAATGGTCGGGACTAAATCAGTATGGA
AAGTCGGACGGGCCATTCTCACCATCATCGCGAGCCAACCTAGCCACACCTCCGACCTCCGGCGTCCCGAGCGTA
CCGCTAAGTCCCAGTGGGCCACCTCCTTCGATATCACCCTCCATCCGAAGCGGTAACCCATCCCCGCCCAGCTCA
GTCGCCGCAAGATCCAGTTCCGGGACACTAGGAGACGGCCCGCGCGATGGAAGACGCTATCGTCAGATGGAGGAG
ATCCTGGGCCAGCACTACGTGGTCCTGAAAAGATTCCTGAATGGCACAGCCCGCGACGACCGTGGCAAGTCGAAT
AAAGCCCGAGATAAACTGCTGCGGCTATCGCCAACCCAGTTCCATGAACTTTCCACCGATGTTTACGACGAATTG
ATCCGGCGACAGCAGGCCTCGCCGCCTCCTGGACGGCCACCTCGTACGGACGTGCCTCCTTATCTCCCCGCTCGA
AGCGACTTCCACGAAAAGCGCAACCATGCCCGCCAAAAGCTTGCTGCGCTCCACCACGTGCGCTTCCGAGATTTG
GCGACCGATGTCTTCTGTGAGCTGGAGCGCCGCTTCCCGCATTTCACCAGCCGAGATTACCGCGCCCGACCGCCT
CCCAATATGGGCCCTGGTAGCGCTCGCACCTCGCAACAGTCTGCTCGGGGTCCTCCCCCGCATATGGGCCGCGGG
TACCCGTCTGGTGGTCCCCCAGGCAGTCCGTTTCCTCCGCGTGCTGGCTCTCTTGGGGGCCCACCGAGTATAAAT
GGCGATGGACCGTTTCCTCGGTCTTTCCAGAGCAATACTATGGTCCCGAATAAGAGCACGATGGTCGAGGATAGC
GATGATATGGGGCCAGATGATGAGGATGATGCTCGGAGTGATGCGTTCGCTCTAGATGCTCTGAGCCGACGGGGT
ACTACAACGACCTTGGGTGAGAGTGAGCGGAGATTGTTATTAGAAAGCCAGACACAAGTATCGGTTCTCCAAGAT
AAGATCGAAAAGTTGGAAGAATTAGTCCGCGCCAAGGATGAAGAGTTGGCCCAGTCATCACAAGATGCAGATTCT
TCCGGGATCAGTCATAACGAACGCCAGGAGTGGGACGAGTTACGACATGATCTTGAGAGTAAGGTATCAAAAGCC
GAGGATCTCAACAGCTCGCTTCAGCTAGAGCTTGAGCGGGTTAGAACCGAGCACGAGACTGTGGAACGAGATCTT
CGCAGTCAGCTTAATGACTCTTCCCGGGGTGTCGATGATGCGGGTCTACAAGCGCGCTATGTTGATCTAGAGACT
CAGCACCAGAACTTGCAGGCAGAGTTGCAGCAGCAGAAACAGGTGACCGACGAGGTCCGCCGCGAGGCAGCGGCT
TTCCTGACGGAAATGAAGACTCTTTCAGCCGAGAGTCAGTCTAATTGGGAGCGCGAAGAACAGCTCTCGCATGAG
GTGCACAGACTCGAGGCAGATGCCAACGAATGGAAGCATCGTTATGCCAAGGTCAAGGCGCAGCTGCGGCATCTT
CGCACGTCCTCTGGTGGTTTCGCCGACTCGCGGCCCGACGCAAGTCTTGTCGCCAAAGAGCATGAGTTGGTGCAA
GCCGACGGGTTGGTCAAAGATATCCATGTTACTAAGTTCCAGGTATCTGTGGACGAGCTCCTGCGAGTTGCGCGT
TTCGAGGAATCGCATGTGGTGCTCCAACACATTAAGATGGTCATTGTAACAGTTCGCCATATTCTGCAGGACGTG
GAGTATTCCTCGATCCCGGTGGATGGGTCGGCTGCTCTGCGCGCAAAGGTCAAGGGCCAGGTGTCTACGACAGCA
AACAACATGATCACCGCTACCCGCAACTTCGCTAGCTCTGGTGGTTTATCCCCGGTGTCGCTCCTTGATGCAGCG
GCCTCACATCTTTGCACCGCTATTGTTGACCTGATACGGGTGGTGAAGATCCAGGCATCGCCTATAGATGAGCTG
GAGGATGAAGATTATGAGGTGGATGTACCTCAAGACCAATTCCCCGACTATTTTGGTACATCTGGCAGTCAAAAG
CGGATGAGCAATAACTCCGTCTACAGTGCTATTAGTCGTCCAGATGACTCTCAGTACCCTGCGCAGAATGGCGCG
ACTAATGACCTCAATCATGGCTGGGGGCATGTGCAAGAAGATCATGAGGTGTTGGAACTTAAGCTCTATGTCGAG
GACCAGACCGATGGCATGGTCCAACAAATCCAGGCTTTGGTGGCCAGTATCCGAGCCGAGGACAACCTGCAAACT
GTTCAGACGCACGTATCTGCCATTTCGAACGTTGTTGCGAATGTGGTATCCGCTACAGAGCAGTTGATGCGCGAA
CGCAGCGGAGACATCACTTTGCGGCAGACATCTGAACCAGTCATCGCGGCATTGGACCAGTGTCGCGGCCGGTTG
GCGGCCACTGCCGGTGAGGGCCAAGACGCCACCACCCCGGAGCAATTGCATGAGCTCACGAACAAACTGCCTCCC
ATTGCATTTGAGATCGCTCGGCAGATCAAAGACCTCGTTCAGCGGCTTGAGGCTACATCGGTGGCTACTGGCGAG
GAAGATGACTTCCGGTAA
Transcript >Pro_DTO377G3_2|g5137.t1
ATGCATGGGGGTTCGGGAGCCATGTCGCCTGTCTCTGTTGATGGTAGCGAATGGTCGGGACTAAATCAGTATGGA
AAGTCGGACGGGCCATTCTCACCATCATCGCGAGCCAACCTAGCCACACCTCCGACCTCCGGCGTCCCGAGCGTA
CCGCTAAGTCCCAGTGGGCCACCTCCTTCGATATCACCCTCCATCCGAAGCGGTAACCCATCCCCGCCCAGCTCA
GTCGCCGCAAGATCCAGTTCCGGGACACTAGGAGACGGCCCGCGCGATGGAAGACGCTATCGTCAGATGGAGGAG
ATCCTGGGCCAGCACTACGTGGTCCTGAAAAGATTCCTGAATGGCACAGCCCGCGACGACCGTGGCAAGTCGAAT
AAAGCCCGAGATAAACTGCTGCGGCTATCGCCAACCCAGTTCCATGAACTTTCCACCGATGTTTACGACGAATTG
ATCCGGCGACAGCAGGCCTCGCCGCCTCCTGGACGGCCACCTCGTACGGACGTGCCTCCTTATCTCCCCGCTCGA
AGCGACTTCCACGAAAAGCGCAACCATGCCCGCCAAAAGCTTGCTGCGCTCCACCACGTGCGCTTCCGAGATTTG
GCGACCGATGTCTTCTGTGAGCTGGAGCGCCGCTTCCCGCATTTCACCAGCCGAGATTACCGCGCCCGACCGCCT
CCCAATATGGGCCCTGGTAGCGCTCGCACCTCGCAACAGTCTGCTCGGGGTCCTCCCCCGCATATGGGCCGCGGG
TACCCGTCTGGTGGTCCCCCAGGCAGTCCGTTTCCTCCGCGTGCTGGCTCTCTTGGGGGCCCACCGAGTATAAAT
GGCGATGGACCGTTTCCTCGGTCTTTCCAGAGCAATACTATGGTCCCGAATAAGAGCACGATGGTCGAGGATAGC
GATGATATGGGGCCAGATGATGAGGATGATGCTCGGAGTGATGCGTTCGCTCTAGATGCTCTGAGCCGACGGGGT
ACTACAACGACCTTGGGTGAGAGTGAGCGGAGATTGTTATTAGAAAGCCAGACACAAGTATCGGTTCTCCAAGAT
AAGATCGAAAAGTTGGAAGAATTAGTCCGCGCCAAGGATGAAGAGTTGGCCCAGTCATCACAAGATGCAGATTCT
TCCGGGATCAGTCATAACGAACGCCAGGAGTGGGACGAGTTACGACATGATCTTGAGAGTAAGGTATCAAAAGCC
GAGGATCTCAACAGCTCGCTTCAGCTAGAGCTTGAGCGGGTTAGAACCGAGCACGAGACTGTGGAACGAGATCTT
CGCAGTCAGCTTAATGACTCTTCCCGGGGTGTCGATGATGCGGGTCTACAAGCGCGCTATGTTGATCTAGAGACT
CAGCACCAGAACTTGCAGGCAGAGTTGCAGCAGCAGAAACAGGTGACCGACGAGGTCCGCCGCGAGGCAGCGGCT
TTCCTGACGGAAATGAAGACTCTTTCAGCCGAGAGTCAGTCTAATTGGGAGCGCGAAGAACAGCTCTCGCATGAG
GTGCACAGACTCGAGGCAGATGCCAACGAATGGAAGCATCGTTATGCCAAGGTCAAGGCGCAGCTGCGGCATCTT
CGCACGTCCTCTGGTGGTTTCGCCGACTCGCGGCCCGACGCAAGTCTTGTCGCCAAAGAGCATGAGTTGGTGCAA
GCCGACGGGTTGGTCAAAGATATCCATGTTACTAAGTTCCAGGTATCTGTGGACGAGCTCCTGCGAGTTGCGCGT
TTCGAGGAATCGCATGTGGTGCTCCAACACATTAAGATGGTCATTGTAACAGTTCGCCATATTCTGCAGGACGTG
GAGTATTCCTCGATCCCGGTGGATGGGTCGGCTGCTCTGCGCGCAAAGGTCAAGGGCCAGGTGTCTACGACAGCA
AACAACATGATCACCGCTACCCGCAACTTCGCTAGCTCTGGTGGTTTATCCCCGGTGTCGCTCCTTGATGCAGCG
GCCTCACATCTTTGCACCGCTATTGTTGACCTGATACGGGTGGTGAAGATCCAGGCATCGCCTATAGATGAGCTG
GAGGATGAAGATTATGAGGTGGATGTACCTCAAGACCAATTCCCCGACTATTTTGGTACATCTGGCAGTCAAAAG
CGGATGAGCAATAACTCCGTCTACAGTGCTATTAGTCGTCCAGATGACTCTCAGTACCCTGCGCAGAATGGCGCG
ACTAATGACCTCAATCATGGCTGGGGGCATGTGCAAGAAGATCATGAGGTGTTGGAACTTAAGCTCTATGTCGAG
GACCAGACCGATGGCATGGTCCAACAAATCCAGGCTTTGGTGGCCAGTATCCGAGCCGAGGACAACCTGCAAACT
GTTCAGACGCACGTATCTGCCATTTCGAACGTTGTTGCGAATGTGGTATCCGCTACAGAGCAGTTGATGCGCGAA
CGCAGCGGAGACATCACTTTGCGGCAGACATCTGAACCAGTCATCGCGGCATTGGACCAGTGTCGCGGCCGGTTG
GCGGCCACTGCCGGTGAGGGCCAAGACGCCACCACCCCGGAGCAATTGCATGAGCTCACGAACAAACTGCCTCCC
ATTGCATTTGAGATCGCTCGGCAGATCAAAGACCTCGTTCAGCGGCTTGAGGCTACATCGGTGGCTACTGGCGAG
GAAGATGACTTCCGGTAA
Gene >Pro_DTO377G3_2|g5137.t1
ATGCATGGGGGTTCGGGAGCCATGTCGCCTGTCTCTGTTGATGGTAGCGAATGGTCGGGACTAAATCAGTATGGA
AAGTCGGACGGGCCATTCTCACCATCATCGCGAGCCAACCTAGCCACACCTCCGACCTCCGGCGTCCCGAGCGTA
CCGCTAAGTCCCAGTGGGCCACCTCCTTCGATATCACCCTCCATCCGAAGCGGTAACCCATCCCCGCCCAGCTCA
GTCGCCGCAAGATCCAGTTCCGGGACACTAGGAGACGGCCCGCGCGATGGAAGACGCTATCGTCAGATGGAGGAG
ATCCTGGGCCAGCACTACGTGGTCCTGAAAAGATTCCTGAATGGCACAGCCCGCGACGACCGTGGCAAGTCGAAT
AAAGCCCGAGATAAACTGCTGCGGCTATCGCCAACCCAGTTCCATGAACTTTCCACCGATGTTTACGACGAATTG
ATCCGGCGACAGCAGGCCTCGCCGCCTCCTGGACGGCCACCTCGTACGGACGTGCCTCCTTATCTCCCCGCTCGA
AGCGACTTCCACGAAAAGCGCAACCATGCCCGCCAAAAGCTTGCTGCGCTCCACCACGTGCGCTTCCGAGATTTG
GCGACCGATGTCTTCTGTGAGCTGGAGCGCCGCTTCCCGCATTTCACCAGCCGAGATTACCGCGCCCGACCGCCT
CCCAATATGGGCCCTGGTAGCGCTCGCACCTCGCAACAGTCTGCTCGGGGTCCTCCCCCGCATATGGGCCGCGGG
TACCCGTCTGGTGGTCCCCCAGGCAGTCCGTTTCCTCCGCGTGCTGGCTCTCTTGGGGGCCCACCGAGTATAAAT
GGCGATGGACCGTTTCCTCGGTCTTTCCAGAGCAATACTATGGTCCCGAATAAGAGCACGATGGTCGAGGATAGC
GATGATATGGGGCCAGATGATGAGGATGATGCTCGGAGTGATGCGTTCGCTCTAGATGCTCTGAGCCGACGGGGT
ACTACAACGACCTTGGGTGAGAGTGAGCGGAGATTGTTATTAGAAAGCCAGACACAAGTATCGGTTCTCCAAGAT
AAGATCGAAAAGTTGGAAGAATTAGTCCGCGCCAAGGATGAAGAGTTGGCCCAGTCATCACAAGATGCAGATTCT
TCCGGGATCAGTCATAACGAACGCCAGGAGTGGGACGAGTTACGACATGATCTTGAGAGTAAGGTATCAAAAGCC
GAGGATCTCAACAGCTCGCTTCAGCTAGAGCTTGAGCGGGTTAGAACCGAGCACGAGACTGTGGAACGAGATCTT
CGCAGTCAGCTTAATGACTCTTCCCGGGGTGTCGATGATGCGGGTCTACAAGCGCGCTATGTTGATCTAGAGACT
CAGCACCAGAACTTGCAGGCAGAGTTGCAGCAGCAGAAACAGGTGACCGACGAGGTCCGCCGCGAGGCAGCGGCT
TTCCTGACGGAAATGAAGACTCTTTCAGCCGAGAGTCAGTCTAATTGGGAGCGCGAAGAACAGCTCTCGCATGAG
GTGCACAGACTCGAGGCAGATGCCAACGAATGGAAGCATCGTTATGCCAAGGTCAAGGCGCAGCTGCGGCATCTT
CGCACGTCCTCTGGTGGTTTCGCCGACTCGCGGCCCGACGCAAGTCTTGTCGCCAAAGAGCATGAGTTGGTGCAA
GCCGACGGGTTGGTCAAAGATATCCATGTTACTAAGTTCCAGGTATCTGTGGACGAGCTCCTGCGAGTTGCGCGT
TTCGAGGAATCGCATGTGGTGCTCCAACACATTAAGATGGTCATTGTAACAGTTCGCCATATTCTGCAGGACGTG
GAGTATTCCTCGATCCCGGTGGATGGGTCGGCTGCTCTGCGCGCAAAGGTCAAGGGCCAGGTGTCTACGACAGCA
AACAACATGATCACCGCTACCCGCAACTTCGCTAGCTCTGGTGGTTTATCCCCGGTGTCGCTCCTTGATGCAGCG
GCCTCACATCTTTGCACCGCTATTGTTGACCTGATACGGGTGGTGAAGATCCAGGCATCGCCTATAGATGAGCTG
GAGGATGAAGATTATGAGGTGGATGTACCTCAAGACCAATTCCCCGACTATTTTGGTACATCTGGCAGTCAAAAG
CGGATGAGCAATAACTCCGTCTACAGTGCTATTAGTCGTCCAGATGACTCTCAGTACCCTGCGCAGAATGGCGCG
ACTAATGACCTCAATCATGGCTGGGGGCATGTGCAAGAAGATCATGAGGTGTTGGAACTTAAGGTGGGTCGACCG
GAGAAAGATAATACCGCTCAACGAATGATTTACTGACGGATGATCCTAGCTCTATGTCGAGGACCAGACCGATGG
CATGGTCCAACAAATCCAGGCTTTGGTGGCCAGTATCCGAGCCGAGGACAACCTGCAAACTGTTCAGACGCACGT
ATCTGCCATTTCGAACGTTGTTGCGAATGTGGTATCCGCTACAGAGCAGTTGATGCGCGAACGCAGCGGAGACAT
CACTTTGCGGCAGACATCTGAACCAGTCATCGCGGCATTGGACCAGTGTCGCGGCCGGTTGGCGGCCACTGCCGG
TGAGGGCCAAGACGCCACCACCCCGGAGCAATTGCATGAGCTCACGAACAAACTGCCTCCCATTGCATTTGAGAT
CGCTCGGCAGATCAAAGACCTCGTTCAGCGGCTTGAGGCTACATCGGTGGCTACTGGCGAGGAAGATGACTTCCG
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail