Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5136.t1
Gene name
Locationscaffold_11:670524..671358
Strand-
Gene length (bp)834
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD 1.9E-44 24 173

GO

GO Term Description Terminal node
GO:0000413 protein peptidyl-prolyl isomerization Yes
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0018208 peptidyl-proline modification No
GO:0003824 catalytic activity No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0016853 isomerase activity No
GO:0018193 peptidyl-amino acid modification No
GO:0016859 cis-trans isomerase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2741.79 1495.63 3987.95
5d_25C Five days - 25 degrees Celsius 3260.98 1741.65 4780.31
7d_25C Seven days - 25 degrees Celsius 2924.43 1569.21 4279.65
10d_25C Ten days - 25 degrees Celsius 3129.06 1676.21 4581.91
7d_15C Seven days - 15 degrees Celsius 5110.51 2531.99 7689.03
7d_30C Seven days - 30 degrees Celsius 1858.16 1014.70 2701.61

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.571597 no
3d_25C 7d_25C 0.862042 no
3d_25C 7d_15C 0.012904 yes
3d_25C 7d_30C 0.118422 no
3d_25C 10d_25C 0.685200 no
5d_25C 7d_25C 0.753660 no
5d_25C 7d_15C 0.095402 no
5d_25C 7d_30C 0.018295 yes
5d_25C 10d_25C 0.916224 no
7d_25C 7d_15C 0.035449 yes
7d_25C 7d_30C 0.063693 no
7d_25C 10d_25C 0.854589 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.066303 no
7d_30C 10d_25C 0.035014 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5136.t1
MSTPNTTAFFEVQYAPAGSSTPKIGRINFKLYPDEVPKTAKNFAELCNAKQGEGYKGSSFHRVIPQFMLQGGDFT
RGNGTGGRSIYGEKFPDENFVHKHTRPGLLSMANAGPNTNGSQFFITTVATSWLDGKHVVFGEVADNESLKVVKE
IEALGSSSGSIRSAVKPTIVNCGGN*
Coding >Pro_DTO377G3_2|g5136.t1
ATGTCCACCCCCAACACTACCGCTTTCTTCGAGGTCCAGTACGCCCCTGCTGGCTCCTCTACCCCCAAGATTGGC
CGCATCAACTTCAAGCTCTACCCCGACGAGGTCCCTAAGACTGCCAAGAACTTCGCTGAGCTTTGCAACGCCAAG
CAGGGTGAGGGCTACAAGGGCTCTTCCTTCCACCGTGTCATCCCCCAGTTCATGCTCCAGGGTGGTGACTTCACC
CGTGGCAACGGTACCGGTGGCCGCTCCATCTACGGCGAGAAGTTCCCCGATGAGAACTTCGTCCACAAGCACACC
CGCCCTGGTCTTCTGTCCATGGCCAACGCTGGCCCCAACACAAACGGCTCCCAGTTCTTCATCACCACTGTTGCC
ACCTCGTGGCTCGATGGCAAGCACGTCGTCTTCGGCGAGGTCGCTGATAATGAGTCCCTGAAGGTTGTCAAGGAG
ATCGAGGCCCTCGGCTCCTCCTCCGGCTCCATCCGCTCCGCTGTCAAGCCCACCATCGTCAACTGCGGTGGCAAC
TAA
Transcript >Pro_DTO377G3_2|g5136.t1
ATGTCCACCCCCAACACTACCGCTTTCTTCGAGGTCCAGTACGCCCCTGCTGGCTCCTCTACCCCCAAGATTGGC
CGCATCAACTTCAAGCTCTACCCCGACGAGGTCCCTAAGACTGCCAAGAACTTCGCTGAGCTTTGCAACGCCAAG
CAGGGTGAGGGCTACAAGGGCTCTTCCTTCCACCGTGTCATCCCCCAGTTCATGCTCCAGGGTGGTGACTTCACC
CGTGGCAACGGTACCGGTGGCCGCTCCATCTACGGCGAGAAGTTCCCCGATGAGAACTTCGTCCACAAGCACACC
CGCCCTGGTCTTCTGTCCATGGCCAACGCTGGCCCCAACACAAACGGCTCCCAGTTCTTCATCACCACTGTTGCC
ACCTCGTGGCTCGATGGCAAGCACGTCGTCTTCGGCGAGGTCGCTGATAATGAGTCCCTGAAGGTTGTCAAGGAG
ATCGAGGCCCTCGGCTCCTCCTCCGGCTCCATCCGCTCCGCTGTCAAGCCCACCATCGTCAACTGCGGTGGCAAC
TAA
Gene >Pro_DTO377G3_2|g5136.t1
ATGTCCACCCCCAACACTACCGCTTTCTTCGAGGTCCAGTACGCCCCTGCTGGCTCCTCTACCCGTAAGTTTTCC
TGTTATTCTCGTTTCCGGCGGGGCAGGGAGTTTTTGCCTCCGCGCTCCAGCCTCACCTTGCTGTCTCCAACCTTC
AGCTTTCAATGCTAGCATCAAAGCTTGGAGGTTTCACATCATGTCTCAGTAATTGGAATTGAAATTGATGCTAAC
TCCTCATTAGCCAAGATTGGCCGCATCAACTTCAAGCTCTACCCCGACGAGGTCCCTAAGACTGCCAAGAACTTC
GCTGAGCTTTGCAACGCCAAGCAGGGTGAGGGCTACAAGGGCTCTTCCTTCCACCGTGTCATCCCCCAGTTCATG
CTCCAGGGTGGTGACTTCACCCGTGGCAACGTAAGTTTTCTAATCCTGACAACCGCCTAATGCTCGGTATCTGAT
TTTGATTTTACCGGAATAGGGTACCGGTGGCCGCTCCATCTACGGCGAGAAGTTCCCCGATGAGAACTTCGTCCA
CAAGCACACCCGCCCTGGTCTTCTGTCCATGGCCAACGCTGGCCCCAACACGTAAGTCTCAGTCTTGTATCCCGG
CTGGTCTACATCCAGAGAACCATACTGACCGTTTCCCTCTTTTCTAGAAACGGCTCCCAGTTCTTCATCACCACT
GTTGCCACCTCGTGGCTCGATGGCAAGCACGTCGTCTTCGGCGAGGTCGCTGATAATGAGTCCCTGAAGGTTGTC
AAGGAGATCGAGGCCCTCGGCTCCTCCTCCGGCTCCATCCGCTCCGCTGTCAAGCCCACCATCGTCAACTGCGGT
GGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail