Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5121.t1
Gene name
Locationscaffold_11:634657..635157
Strand-
Gene length (bp)500
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase 3.5E-33 31 122

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0016859 cis-trans isomerase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016853 isomerase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5121.t1
MRLTSILVAALGSLAAAADLGIEVTHAVECTRKTVNGDGVAMHYRGTLQSDGSEFDSSYNRKSPLTFKLGTGRVI
KGWDQGLLDMCIGEKRTLTIPPEFGYGDRGVGPIPGGATLVFETELVGIDGVKDEL*
Coding >Pro_DTO377G3_2|g5121.t1
ATGCGTCTCACCTCCATCCTCGTCGCAGCCCTCGGCTCACTCGCAGCTGCCGCCGACCTCGGCATCGAAGTAACC
CACGCTGTCGAATGCACCCGCAAGACCGTCAACGGCGACGGAGTTGCCATGCACTACCGCGGCACACTTCAGTCC
GACGGATCTGAGTTCGATTCCAGCTACAACCGCAAATCGCCTTTGACCTTCAAGCTGGGTACCGGTCGTGTTATC
AAGGGATGGGACCAGGGCTTGTTGGATATGTGCATTGGCGAGAAGCGCACGCTGACTATCCCACCCGAGTTCGGA
TACGGCGACCGCGGTGTCGGGCCGATTCCCGGCGGTGCGACGTTGGTATTTGAGACCGAGTTGGTCGGTATTGAT
GGTGTGAAGGATGAGCTTTGA
Transcript >Pro_DTO377G3_2|g5121.t1
ATGCGTCTCACCTCCATCCTCGTCGCAGCCCTCGGCTCACTCGCAGCTGCCGCCGACCTCGGCATCGAAGTAACC
CACGCTGTCGAATGCACCCGCAAGACCGTCAACGGCGACGGAGTTGCCATGCACTACCGCGGCACACTTCAGTCC
GACGGATCTGAGTTCGATTCCAGCTACAACCGCAAATCGCCTTTGACCTTCAAGCTGGGTACCGGTCGTGTTATC
AAGGGATGGGACCAGGGCTTGTTGGATATGTGCATTGGCGAGAAGCGCACGCTGACTATCCCACCCGAGTTCGGA
TACGGCGACCGCGGTGTCGGGCCGATTCCCGGCGGTGCGACGTTGGTATTTGAGACCGAGTTGGTCGGTATTGAT
GGTGTGAAGGATGAGCTTTGA
Gene >Pro_DTO377G3_2|g5121.t1
ATGCGTCTCACCTCCATCCTCGTCGCAGCCCTCGGCTCACTCGCAGCTGCCGCCGACCTCGGCATCGAAGTAACC
CACGCTGTCGAATGCACCCGCAAGACCGTCAACGGCGACGGAGTTGCCATGCACTACCGCGGCACACTTCAGTCC
GACGGATCTGAGTTCGATTCCAGCTACAACCGCAAATCGCCTTTGACCTTCAAGCTGGGTACCGGTCGTGTTATC
AAGGGGTAAGTTAAAAGCTGCCCGGGGCTGTTTGTGGATGTCAATCTGCAATTGCTGCTTATTATCCGTTGTTCG
CGTGGAAGCTAATTCGTGTGTTCGTTGTATACAGATGGGACCAGGGCTTGTTGGATATGTGCATTGGCGAGAAGC
GCACGCTGACTATCCCACCCGAGTTCGGATACGGCGACCGCGGTGTCGGGCCGATTCCCGGCGGTGCGACGTTGG
TATTTGAGACCGAGTTGGTCGGTATTGATGGTGTGAAGGATGAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail