Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g511.t1
Gene name
Locationscaffold_01:1302163..1303576
Strand-
Gene length (bp)1413
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02176 zf-TRAF TRAF-type zinc finger 1.6E-04 98 139
PF02176 zf-TRAF TRAF-type zinc finger 6.7E-09 179 236
PF15965 zf-TRAF_2 TRAF-like zinc-finger 5.4E-08 163 244
PF13445 zf-RING_UBOX RING-type zinc-finger 8.8E-07 36 78
PF13639 zf-RING_2 Ring finger domain 3.1E-06 35 81
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.5E-06 36 80

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g511.t1
MNLQDFIAMEESRNCDELIDLRSLDLVSEYDPHLMCPICHCPFVEPVRLQCDHVFCGSCLSSAITTFRSTGSDDF
PCPSCRNPTHVVSTSVPRLLINMCDEIRVRCPLITEGCQEIIPRGHVQSHVEKYCGYRLLPCPDNSCDQMTRSKD
VGMDQKCIHRVRRCSYCEQDILEHEYEEHEKELCPVLEVTCADCQTVVTRGALREHIESCPEVAVPCAASKYACP
VKIRRADIAAHEQSCPIVAMGPYFEMQNTRLNSLESSMRHLQQRNEIFEDGLANIRSTLVESTRFANSQSGGQST
QSGREQQSSTRVDVHTDDPADIAASVFSSNATTYLLSLHESLREEVNQLSHAITDLDARASMAIMNECLRMKEDI
AHTNAAVNSVRMQVQWLMNPRLHQGTRAVRTNSTENEGTRTQMASSAAGPSHATGHSSGPLRPRRPSDGGREGTK
L*
Coding >Pro_DTO377G3_2|g511.t1
ATGAATCTACAAGACTTTATAGCCATGGAGGAAAGCCGCAACTGCGACGAGCTAATCGACCTCCGCAGCCTTGAT
CTCGTCTCCGAGTACGACCCGCATCTTATGTGCCCGATCTGCCACTGTCCCTTCGTTGAACCCGTTCGTCTACAA
TGCGACCATGTCTTCTGCGGGAGCTGCCTCAGTTCGGCCATCACCACGTTCCGCTCGACCGGCTCAGACGACTTC
CCGTGTCCTTCTTGCCGGAATCCCACTCATGTAGTGTCAACTAGCGTGCCCCGCCTGCTGATCAACATGTGCGAC
GAGATCCGAGTGCGATGTCCATTGATAACGGAGGGATGTCAAGAGATCATTCCCCGAGGCCATGTCCAGTCGCAT
GTCGAGAAGTACTGTGGTTACCGGCTATTGCCGTGTCCGGATAATTCATGCGATCAGATGACGCGAAGCAAGGAC
GTTGGGATGGATCAGAAGTGTATTCATAGAGTGCGACGGTGCTCTTATTGCGAACAAGATATTCTAGAGCATGAA
TACGAGGAGCATGAGAAAGAGCTTTGTCCAGTTCTTGAGGTCACATGTGCCGACTGCCAGACAGTTGTCACTAGG
GGGGCGCTACGGGAACACATTGAATCATGTCCGGAGGTTGCGGTTCCTTGCGCCGCATCCAAATACGCATGTCCA
GTTAAGATCCGACGGGCAGACATTGCAGCACACGAGCAAAGCTGTCCCATAGTCGCAATGGGCCCATACTTTGAG
ATGCAGAATACCCGGCTCAATTCCCTTGAATCAAGCATGCGACATTTGCAGCAGCGGAATGAGATATTCGAGGAT
GGACTCGCCAACATTCGGTCCACTCTTGTCGAATCCACGCGCTTTGCGAACAGTCAAAGCGGTGGACAGTCTACC
CAATCTGGCCGAGAACAGCAATCCTCCACTCGTGTTGACGTCCATACCGATGATCCTGCAGACATTGCAGCGAGT
GTATTTTCATCCAATGCCACGACCTACCTGCTTTCGCTGCACGAATCTCTCCGAGAGGAGGTCAACCAACTTTCG
CATGCTATCACAGACCTAGATGCTCGCGCCAGCATGGCTATCATGAATGAATGTCTACGCATGAAGGAAGACATA
GCCCACACGAATGCGGCGGTCAACAGTGTGCGCATGCAAGTCCAGTGGCTCATGAACCCTCGTCTTCACCAGGGG
ACACGGGCTGTTCGCACCAATTCTACAGAAAACGAAGGAACACGGACCCAGATGGCATCGTCAGCGGCTGGGCCG
AGCCATGCTACCGGCCACTCTTCAGGGCCTCTTCGGCCCAGGCGTCCCAGTGACGGTGGACGCGAGGGAACGAAG
TTGTGA
Transcript >Pro_DTO377G3_2|g511.t1
ATGAATCTACAAGACTTTATAGCCATGGAGGAAAGCCGCAACTGCGACGAGCTAATCGACCTCCGCAGCCTTGAT
CTCGTCTCCGAGTACGACCCGCATCTTATGTGCCCGATCTGCCACTGTCCCTTCGTTGAACCCGTTCGTCTACAA
TGCGACCATGTCTTCTGCGGGAGCTGCCTCAGTTCGGCCATCACCACGTTCCGCTCGACCGGCTCAGACGACTTC
CCGTGTCCTTCTTGCCGGAATCCCACTCATGTAGTGTCAACTAGCGTGCCCCGCCTGCTGATCAACATGTGCGAC
GAGATCCGAGTGCGATGTCCATTGATAACGGAGGGATGTCAAGAGATCATTCCCCGAGGCCATGTCCAGTCGCAT
GTCGAGAAGTACTGTGGTTACCGGCTATTGCCGTGTCCGGATAATTCATGCGATCAGATGACGCGAAGCAAGGAC
GTTGGGATGGATCAGAAGTGTATTCATAGAGTGCGACGGTGCTCTTATTGCGAACAAGATATTCTAGAGCATGAA
TACGAGGAGCATGAGAAAGAGCTTTGTCCAGTTCTTGAGGTCACATGTGCCGACTGCCAGACAGTTGTCACTAGG
GGGGCGCTACGGGAACACATTGAATCATGTCCGGAGGTTGCGGTTCCTTGCGCCGCATCCAAATACGCATGTCCA
GTTAAGATCCGACGGGCAGACATTGCAGCACACGAGCAAAGCTGTCCCATAGTCGCAATGGGCCCATACTTTGAG
ATGCAGAATACCCGGCTCAATTCCCTTGAATCAAGCATGCGACATTTGCAGCAGCGGAATGAGATATTCGAGGAT
GGACTCGCCAACATTCGGTCCACTCTTGTCGAATCCACGCGCTTTGCGAACAGTCAAAGCGGTGGACAGTCTACC
CAATCTGGCCGAGAACAGCAATCCTCCACTCGTGTTGACGTCCATACCGATGATCCTGCAGACATTGCAGCGAGT
GTATTTTCATCCAATGCCACGACCTACCTGCTTTCGCTGCACGAATCTCTCCGAGAGGAGGTCAACCAACTTTCG
CATGCTATCACAGACCTAGATGCTCGCGCCAGCATGGCTATCATGAATGAATGTCTACGCATGAAGGAAGACATA
GCCCACACGAATGCGGCGGTCAACAGTGTGCGCATGCAAGTCCAGTGGCTCATGAACCCTCGTCTTCACCAGGGG
ACACGGGCTGTTCGCACCAATTCTACAGAAAACGAAGGAACACGGACCCAGATGGCATCGTCAGCGGCTGGGCCG
AGCCATGCTACCGGCCACTCTTCAGGGCCTCTTCGGCCCAGGCGTCCCAGTGACGGTGGACGCGAGGGAACGAAG
TTGTGA
Gene >Pro_DTO377G3_2|g511.t1
ATGAATCTACAAGACTTTATAGCCATGGAGGAAAGCCGCAACTGCGACGAGCTAATCGACCTCCGCAGCCTTGAT
CTCGTCTCCGAGTACGACCCGCATCTTATGTGCCCGATCTGCCACTGTCCCTTCGTTGAACCCGTTCGTCTACAA
TGCGACCATGTCTTCTGCGGGAGCTGCCTCAGTTCGGCCATCACCACGTTCCGCTCGACCGGCTCAGACGACTTC
CCGTGTCCTTCTTGCCGGAATCCCACTCATGTAGTGTCAACTAGCGTGCCCCGCCTGCTGATCAACATGTGCGAC
GAGATCCGAGTGCGATGTCCATTGATAACGGAGGGATGTCAAGAGATCATTCCCCGAGGCCATGTCCAGTCGCAT
GTCGAGAAGTACTGTGGTTACCGGCTATTGCCGTGTCCGGATAATTCATGCGATCAGATGACGCGAAGCAAGGAC
GTTGGGATGGATCAGAAGTGTATTCATAGAGTGCGACGGTGCTCTTATTGCGAACAAGATATTCTAGAGCATGAA
TACGAGGTTTGTTCCATTTTTAACCTCTTAGAAATTATATAGATGCTGACTAGAAACGCCTAGGAGCATGAGAAA
GAGCTTTGTCCAGTTCTTGAGGTCACATGTGCCGACTGCCAGACAGTTGTCACTAGGGGGGCGCTACGGGAACAC
ATTGAATCATGTCCGGAGGTTGCGGTTCCTTGCGCCGCATCCAAATACGCATGTCCAGTTAAGATCCGACGGGCA
GACATTGCAGCACACGAGCAAAGCTGTCCCATAGTCGCAATGGGCCCATACTTTGAGATGCAGAATACCCGGCTC
AATTCCCTTGAATCAAGCATGCGACATTTGCAGCAGCGGAATGAGATATTCGAGGATGGACTCGCCAACATTCGG
TCCACTCTTGTCGAATCCACGCGCTTTGCGAACAGTCAAAGCGGTGGACAGTCTACCCAATCTGGCCGAGAACAG
CAATCCTCCACTCGTGTTGACGTCCATACCGATGATCCTGCAGACATTGCAGCGAGTGTATTTTCATCCAATGCC
ACGACCTACCTGCTTTCGCTGCACGAATCTCTCCGAGAGGAGGTCAACCAACTTTCGCATGCTATCACAGACCTA
GATGCTCGCGCCAGCATGGCTATCATGAATGAATGTCTACGCATGAAGGAAGACATAGCCCACACGAATGCGGCG
GTCAACAGTGTGCGCATGCAAGTCCAGTGGCTCATGAACCCTCGTCTTCACCAGGGGACACGGGCTGTTCGCACC
AATTCTACAGAAAACGAAGGAACACGGACCCAGATGGCATCGTCAGCGGCTGGGCCGAGCCATGCTACCGGCCAC
TCTTCAGGGCCTCTTCGGCCCAGGCGTCCCAGTGACGGTGGACGCGAGGGAACGAAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail