Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5081.t1
Gene name
Locationscaffold_11:523337..524089
Strand-
Gene length (bp)752
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08229 SHR3_chaperone ER membrane protein SH3 7.4E-79 6 199

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 61 83 22
3 90 112 22
4 146 164 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 130.06 76.76 183.35
5d_25C Five days - 25 degrees Celsius 122.96 71.98 173.94
7d_25C Seven days - 25 degrees Celsius 126.43 74.65 178.20
10d_25C Ten days - 25 degrees Celsius 145.94 87.13 204.75
7d_15C Seven days - 15 degrees Celsius 115.55 66.62 164.48
7d_30C Seven days - 30 degrees Celsius 128.92 76.29 181.54

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.872751 no
3d_25C 7d_25C 0.935911 no
3d_25C 7d_15C 0.699883 no
3d_25C 7d_30C 0.981280 no
3d_25C 10d_25C 0.696530 no
5d_25C 7d_25C 0.938445 no
5d_25C 7d_15C 0.855330 no
5d_25C 7d_30C 0.890180 no
5d_25C 10d_25C 0.528194 no
7d_25C 7d_15C 0.772701 no
7d_25C 7d_30C 0.956077 no
7d_25C 10d_25C 0.601747 no
7d_15C 7d_30C 0.721508 no
7d_15C 10d_25C 0.362045 no
7d_30C 10d_25C 0.666684 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5081.t1
MAFKSGSFATFMIVCPTCFFLGIIFSLFPYDYPILWSTVLTPTAHYDYLEAHLRFLHASPPLIPRILHIVIFVGL
AGLLTKLYKPSESNMLFDGASLVLYMCGVTVYIANIVKGLRLASAGRYGAELATSTDENEQILGREDSLKVLSAS
NTILALVLVGILVLQAGQWYAERKDAQEDESFATSKKTEKESGEATATTSGASTAIAGKSGRQGSQRKKSN*
Coding >Pro_DTO377G3_2|g5081.t1
ATGGCCTTCAAAAGCGGCTCGTTCGCGACTTTCATGATTGTCTGCCCGACCTGTTTCTTCTTGGGCATTATCTTC
TCCCTCTTCCCTTACGACTACCCGATCTTGTGGTCCACAGTGTTGACACCTACCGCACACTATGACTACCTCGAA
GCGCATCTCCGCTTCCTGCACGCCTCGCCCCCGCTCATCCCACGCATCCTGCACATCGTAATTTTCGTCGGCCTA
GCCGGCCTCCTCACGAAGCTCTACAAGCCCTCCGAATCAAACATGCTCTTCGACGGCGCCTCGCTGGTTCTCTAC
ATGTGCGGCGTGACAGTCTACATCGCCAACATCGTCAAGGGTCTGCGCCTCGCCTCTGCCGGCCGGTACGGCGCC
GAGCTGGCTACCTCCACCGACGAGAATGAGCAGATCCTTGGTCGCGAGGACTCGCTCAAGGTTCTTTCCGCTAGC
AATACTATTCTGGCCCTCGTCCTCGTTGGCATCCTGGTCCTGCAGGCTGGGCAGTGGTACGCGGAGCGCAAGGAT
GCGCAGGAAGATGAATCGTTTGCTACTAGCAAGAAGACTGAGAAGGAGTCTGGCGAGGCGACGGCTACTACTTCC
GGTGCGTCGACTGCGATTGCTGGGAAGTCTGGTCGGCAGGGAAGCCAGCGTAAGAAGAGCAATTAA
Transcript >Pro_DTO377G3_2|g5081.t1
ATGGCCTTCAAAAGCGGCTCGTTCGCGACTTTCATGATTGTCTGCCCGACCTGTTTCTTCTTGGGCATTATCTTC
TCCCTCTTCCCTTACGACTACCCGATCTTGTGGTCCACAGTGTTGACACCTACCGCACACTATGACTACCTCGAA
GCGCATCTCCGCTTCCTGCACGCCTCGCCCCCGCTCATCCCACGCATCCTGCACATCGTAATTTTCGTCGGCCTA
GCCGGCCTCCTCACGAAGCTCTACAAGCCCTCCGAATCAAACATGCTCTTCGACGGCGCCTCGCTGGTTCTCTAC
ATGTGCGGCGTGACAGTCTACATCGCCAACATCGTCAAGGGTCTGCGCCTCGCCTCTGCCGGCCGGTACGGCGCC
GAGCTGGCTACCTCCACCGACGAGAATGAGCAGATCCTTGGTCGCGAGGACTCGCTCAAGGTTCTTTCCGCTAGC
AATACTATTCTGGCCCTCGTCCTCGTTGGCATCCTGGTCCTGCAGGCTGGGCAGTGGTACGCGGAGCGCAAGGAT
GCGCAGGAAGATGAATCGTTTGCTACTAGCAAGAAGACTGAGAAGGAGTCTGGCGAGGCGACGGCTACTACTTCC
GGTGCGTCGACTGCGATTGCTGGGAAGTCTGGTCGGCAGGGAAGCCAGCGTAAGAAGAGCAATTAA
Gene >Pro_DTO377G3_2|g5081.t1
ATGGCCTTCAAAAGCGGCTCGTTCGCGACTTTCATGATTGTCTGCCGTAAGTCCATCGCATCGCGAGTCCCCGGA
CTCCAACGGCAAAGAGGCCACGAGACTGTAATAAACTAACTCAGTCTGCCCAACCAGCGACCTGTTTCTTCTTGG
GCATTATCTTCTCCCTCTTCCCTTACGACTACCCGATCTTGTGGTCCACAGTGTTGACACCTACCGCACACTATG
ACTACCTCGAAGCGCATCTCCGCTTCCTGCACGCCTCGCCCCCGCTCATCCCACGCATCCTGCACATCGTAATTT
TCGTCGGCCTAGCCGGCCTCCTCACGAAGCTCTACAAGCCCTCCGAATCAAACATGCTCTTCGACGGCGCCTCGC
TGGTTCTCTACATGTGCGGCGTGACAGTCTACATCGCCAACATCGTCAAGGGTCTGCGCCTCGCCTCTGCCGGCC
GGTACGGCGCCGAGCTGGCTACCTCCACCGACGAGAATGAGCAGATCCTTGGTCGCGAGGACTCGCTCAAGGTTC
TTTCCGCTAGCAATACTATTCTGGCCCTCGTCCTCGTTGGCATCCTGGTCCTGCAGGCTGGGCAGTGGTACGCGG
AGCGCAAGGATGCGCAGGAAGATGAATCGTTTGCTACTAGCAAGAAGACTGAGAAGGAGTCTGGCGAGGCGACGG
CTACTACTTCCGGTGCGTCGACTGCGATTGCTGGGAAGTCTGGTCGGCAGGGAAGCCAGCGTAAGAAGAGCAATT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail