Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5074.t1
Gene name
Locationscaffold_11:494738..496815
Strand-
Gene length (bp)2077
Transcript length (bp)1992
Coding sequence length (bp)1992
Protein length (aa) 664

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 2.0E-130 169 592
PF14558 TRP_N ML-like domain 8.5E-34 28 164

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 169 191 22
2 204 226 22
3 319 341 22
4 367 389 22
5 394 416 22
6 455 477 22
7 481 503 22
8 510 532 22
9 542 575 33

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5074.t1
MQLNGSLFGALILVLQSLQLVQAENLIQATGLTQCSDSAEVTVNNFNAIFTPNNKSISIIFDGYSEVAGDVLIDV
DLLVYGYKAFTKSFDPCSLDLSVFCPMKAIELQIPKITQTLGDSVLSQIPSIAYSVPDIDAVIRLRLKYKNSGKQ
ITCLETRVRNGKTVYQRGVSWTLAVITGLGLIMSTVISLLGHSNTATHLVFRSLAFLGFIQTQAMVGMCSMALPP
FVQSWTQNMQWSLGIVQLDALQTIATWFQRATGGTPSTVLESASTASVVLQKRSAGIHRRAAEEGTQILLRGIKR
VGIRENIELSNIFMTGYLFYYFVTAVIVICVGLVLLVRSVLAKKQTMLPKLDRAISVTADWKTILRNTFFRLACI
GYPQMCILCLWELTRHDSAAEIVLAITMWLVTTAVLAFATFKVFQRAIRSKQQHNTPAYTLYSDPATLNQWGFLY
IYYRAPVYYFIVPALVYIIVKGMVIAFAQPSPIAQSIILLVLELSMMLATSIIKPFMSKGANVAAITMTVMNSLN
TIFMLVWTNIFDQPELMTGILGVIFFILNALLTLLLLIYLLVGMVYAIFFKKPDTKYKPLGDDRDSFRWSRTGTT
TELSSLEKIARGEDDTEGHPHPPPVVTAPPSDEDVSMAAKRPYNDVVDPSLPLFPASYERTQR*
Coding >Pro_DTO377G3_2|g5074.t1
ATGCAACTGAATGGCTCCCTTTTCGGAGCTCTCATCCTCGTCCTCCAGAGTCTTCAGCTTGTACAAGCAGAGAAC
CTCATCCAAGCCACCGGGCTGACACAATGTTCCGATAGTGCCGAAGTGACCGTCAATAACTTCAATGCGATATTC
ACGCCAAACAACAAGTCCATCAGCATCATCTTTGATGGCTATTCCGAAGTGGCCGGAGATGTGCTCATTGACGTG
GACCTCCTGGTGTACGGATACAAGGCGTTTACCAAGTCGTTCGATCCATGCAGTCTCGATTTGTCGGTGTTTTGT
CCTATGAAAGCAATTGAACTGCAAATTCCCAAAATCACCCAAACATTGGGCGACAGTGTCCTCTCGCAAATACCA
TCGATCGCCTATAGCGTCCCCGACATCGATGCAGTGATTCGGCTCAGGCTCAAGTACAAAAATTCAGGTAAACAG
ATCACTTGTTTGGAGACCCGTGTCCGCAATGGGAAAACAGTCTACCAGCGTGGTGTGTCGTGGACACTCGCTGTC
ATCACCGGTCTTGGTCTCATCATGTCCACGGTCATATCGCTTCTTGGCCATTCGAACACGGCTACCCATCTCGTC
TTCCGATCGCTTGCATTCCTCGGATTCATTCAAACACAGGCGATGGTTGGGATGTGTTCAATGGCATTGCCGCCG
TTTGTGCAATCCTGGACTCAGAACATGCAATGGAGCTTAGGAATTGTGCAGCTGGATGCTCTGCAGACAATTGCG
ACCTGGTTTCAGCGCGCCACCGGGGGTACACCTTCGACCGTGCTTGAATCGGCGAGTACTGCATCTGTCGTCTTA
CAGAAGCGTTCCGCCGGGATCCATCGCAGAGCCGCAGAGGAAGGAACTCAAATTCTTCTTCGCGGTATTAAACGG
GTTGGAATTCGCGAAAACATCGAACTGAGCAACATCTTTATGACCGGATATCTATTCTATTACTTCGTCACCGCA
GTCATCGTCATCTGTGTAGGGTTGGTTCTCCTAGTCCGGAGTGTTTTAGCCAAGAAACAGACAATGCTTCCAAAG
TTGGATCGTGCCATCAGTGTCACCGCAGATTGGAAAACCATCCTCCGCAATACCTTCTTCCGGCTGGCATGCATC
GGATACCCACAGATGTGTATCCTATGTCTCTGGGAACTGACTCGTCACGACTCAGCCGCTGAAATTGTCCTGGCC
ATTACCATGTGGCTGGTCACGACTGCCGTCTTAGCCTTTGCCACATTCAAGGTGTTCCAACGCGCGATACGGTCG
AAACAGCAGCACAACACACCTGCGTACACGCTCTACTCCGACCCGGCCACTCTGAACCAGTGGGGTTTCCTATAC
ATCTACTATCGCGCTCCGGTCTATTACTTCATTGTCCCAGCTCTGGTCTACATCATTGTTAAAGGAATGGTTATT
GCCTTCGCTCAGCCTTCACCGATCGCCCAGTCGATCATTCTGCTCGTTTTGGAACTCTCCATGATGCTCGCAACC
TCCATAATCAAGCCGTTCATGAGCAAGGGGGCTAATGTCGCTGCAATCACGATGACGGTAATGAATTCGCTCAAT
ACGATATTCATGCTTGTTTGGACGAATATCTTTGACCAACCTGAGCTCATGACTGGCATCCTGGGGGTAATCTTC
TTCATCCTGAATGCGCTTCTCACTCTCTTGCTCCTGATCTACCTTTTGGTTGGTATGGTTTACGCCATTTTCTTC
AAGAAGCCCGACACCAAGTACAAACCTCTTGGCGATGACCGTGACTCTTTCCGCTGGTCTCGCACCGGAACGACG
ACTGAGTTGTCGTCCCTCGAGAAGATCGCAAGAGGCGAGGACGACACAGAAGGCCACCCTCATCCCCCGCCCGTG
GTCACTGCTCCGCCCAGCGACGAAGATGTGTCAATGGCAGCCAAAAGGCCATATAATGATGTTGTGGACCCTTCG
CTGCCGCTCTTCCCAGCCAGCTATGAACGCACGCAACGATAG
Transcript >Pro_DTO377G3_2|g5074.t1
ATGCAACTGAATGGCTCCCTTTTCGGAGCTCTCATCCTCGTCCTCCAGAGTCTTCAGCTTGTACAAGCAGAGAAC
CTCATCCAAGCCACCGGGCTGACACAATGTTCCGATAGTGCCGAAGTGACCGTCAATAACTTCAATGCGATATTC
ACGCCAAACAACAAGTCCATCAGCATCATCTTTGATGGCTATTCCGAAGTGGCCGGAGATGTGCTCATTGACGTG
GACCTCCTGGTGTACGGATACAAGGCGTTTACCAAGTCGTTCGATCCATGCAGTCTCGATTTGTCGGTGTTTTGT
CCTATGAAAGCAATTGAACTGCAAATTCCCAAAATCACCCAAACATTGGGCGACAGTGTCCTCTCGCAAATACCA
TCGATCGCCTATAGCGTCCCCGACATCGATGCAGTGATTCGGCTCAGGCTCAAGTACAAAAATTCAGGTAAACAG
ATCACTTGTTTGGAGACCCGTGTCCGCAATGGGAAAACAGTCTACCAGCGTGGTGTGTCGTGGACACTCGCTGTC
ATCACCGGTCTTGGTCTCATCATGTCCACGGTCATATCGCTTCTTGGCCATTCGAACACGGCTACCCATCTCGTC
TTCCGATCGCTTGCATTCCTCGGATTCATTCAAACACAGGCGATGGTTGGGATGTGTTCAATGGCATTGCCGCCG
TTTGTGCAATCCTGGACTCAGAACATGCAATGGAGCTTAGGAATTGTGCAGCTGGATGCTCTGCAGACAATTGCG
ACCTGGTTTCAGCGCGCCACCGGGGGTACACCTTCGACCGTGCTTGAATCGGCGAGTACTGCATCTGTCGTCTTA
CAGAAGCGTTCCGCCGGGATCCATCGCAGAGCCGCAGAGGAAGGAACTCAAATTCTTCTTCGCGGTATTAAACGG
GTTGGAATTCGCGAAAACATCGAACTGAGCAACATCTTTATGACCGGATATCTATTCTATTACTTCGTCACCGCA
GTCATCGTCATCTGTGTAGGGTTGGTTCTCCTAGTCCGGAGTGTTTTAGCCAAGAAACAGACAATGCTTCCAAAG
TTGGATCGTGCCATCAGTGTCACCGCAGATTGGAAAACCATCCTCCGCAATACCTTCTTCCGGCTGGCATGCATC
GGATACCCACAGATGTGTATCCTATGTCTCTGGGAACTGACTCGTCACGACTCAGCCGCTGAAATTGTCCTGGCC
ATTACCATGTGGCTGGTCACGACTGCCGTCTTAGCCTTTGCCACATTCAAGGTGTTCCAACGCGCGATACGGTCG
AAACAGCAGCACAACACACCTGCGTACACGCTCTACTCCGACCCGGCCACTCTGAACCAGTGGGGTTTCCTATAC
ATCTACTATCGCGCTCCGGTCTATTACTTCATTGTCCCAGCTCTGGTCTACATCATTGTTAAAGGAATGGTTATT
GCCTTCGCTCAGCCTTCACCGATCGCCCAGTCGATCATTCTGCTCGTTTTGGAACTCTCCATGATGCTCGCAACC
TCCATAATCAAGCCGTTCATGAGCAAGGGGGCTAATGTCGCTGCAATCACGATGACGGTAATGAATTCGCTCAAT
ACGATATTCATGCTTGTTTGGACGAATATCTTTGACCAACCTGAGCTCATGACTGGCATCCTGGGGGTAATCTTC
TTCATCCTGAATGCGCTTCTCACTCTCTTGCTCCTGATCTACCTTTTGGTTGGTATGGTTTACGCCATTTTCTTC
AAGAAGCCCGACACCAAGTACAAACCTCTTGGCGATGACCGTGACTCTTTCCGCTGGTCTCGCACCGGAACGACG
ACTGAGTTGTCGTCCCTCGAGAAGATCGCAAGAGGCGAGGACGACACAGAAGGCCACCCTCATCCCCCGCCCGTG
GTCACTGCTCCGCCCAGCGACGAAGATGTGTCAATGGCAGCCAAAAGGCCATATAATGATGTTGTGGACCCTTCG
CTGCCGCTCTTCCCAGCCAGCTATGAACGCACGCAACGATAG
Gene >Pro_DTO377G3_2|g5074.t1
ATGCAACTGAATGGCTCCCTTTTCGGAGCTCTCATCCTCGTCCTCCAGAGTCTTCAGCTTGTACAAGCAGAGAAC
CTCATCCAAGCCACCGGGCTGACACAATGTTCCGATAGTGCCGAAGTGACCGTCAATAACTTCAATGCGATATTC
ACGCCAAACAACAAGTCCATCAGCATCATCTTTGATGGCTATTCCGAAGTGGCCGGAGATGTGCTCATTGACGTG
GACCTCCTGGTGTACGGATACAAGGCGTTTACCAAGTCGTTCGATCCATGCAGTCTCGATTTGTCGGTGTTTTGT
CCTATGAAAGCAATTGAACTGCAAATTCCCAAAATCACCCAAACATTGGGCGACAGTGTCCTCTCGCAAATACCA
TGTTCGTCCACACTTCCCCGATAGTCGCAAATTCTTTCAGGGCTCGGAGACTCCGGAAATTGGTCTTACTAACGG
TTACGTCATAGCGATCGCCTATAGCGTCCCCGACATCGATGCAGTGATTCGGCTCAGGCTCAAGTACAAAAATTC
AGGTAAACAGATCACTTGTTTGGAGACCCGTGTCCGCAATGGGAAAACAGTCTACCAGCGTGGTGTGTCGTGGAC
ACTCGCTGTCATCACCGGTCTTGGTCTCATCATGTCCACGGTCATATCGCTTCTTGGCCATTCGAACACGGCTAC
CCATCTCGTCTTCCGATCGCTTGCATTCCTCGGATTCATTCAAACACAGGCGATGGTTGGGATGTGTTCAATGGC
ATTGCCGCCGTTTGTGCAATCCTGGACTCAGAACATGCAATGGAGCTTAGGAATTGTGCAGCTGGATGCTCTGCA
GACAATTGCGACCTGGTTTCAGCGCGCCACCGGGGGTACACCTTCGACCGTGCTTGAATCGGCGAGTACTGCATC
TGTCGTCTTACAGAAGCGTTCCGCCGGGATCCATCGCAGAGCCGCAGAGGAAGGAACTCAAATTCTTCTTCGCGG
TATTAAACGGGTTGGAATTCGCGAAAACATCGAACTGAGCAACATCTTTATGACCGGATATCTATTCTATTACTT
CGTCACCGCAGTCATCGTCATCTGTGTAGGGTTGGTTCTCCTAGTCCGGAGTGTTTTAGCCAAGAAACAGACAAT
GCTTCCAAAGTTGGATCGTGCCATCAGTGTCACCGCAGATTGGAAAACCATCCTCCGCAATACCTTCTTCCGGCT
GGCATGCATCGGATACCCACAGATGTGTATCCTATGTCTCTGGGAACTGACTCGTCACGACTCAGCCGCTGAAAT
TGTCCTGGCCATTACCATGTGGCTGGTCACGACTGCCGTCTTAGCCTTTGCCACATTCAAGGTGTTCCAACGCGC
GATACGGTCGAAACAGCAGCACAACACACCTGCGTACACGCTCTACTCCGACCCGGCCACTCTGAACCAGTGGGG
TTTCCTATACATCTACTATCGCGCTCCGGTCTATTACTTCATTGTCCCAGCTCTGGTCTACATCATTGTTAAAGG
AATGGTTATTGCCTTCGCTCAGCCTTCACCGATCGCCCAGTCGATCATTCTGCTCGTTTTGGAACTCTCCATGAT
GCTCGCAACCTCCATAATCAAGCCGTTCATGAGCAAGGGGGCTAATGTCGCTGCAATCACGATGACGGTAATGAA
TTCGCTCAATACGATATTCATGCTTGTTTGGACGAATATCTTTGACCAACCTGAGCTCATGACTGGCATCCTGGG
GGTAATCTTCTTCATCCTGAATGCGCTTCTCACTCTCTTGCTCCTGATCTACCTTTTGGTTGGTATGGTTTACGC
CATTTTCTTCAAGAAGCCCGACACCAAGTACAAACCTCTTGGCGATGACCGTGACTCTTTCCGCTGGTCTCGCAC
CGGAACGACGACTGAGTTGTCGTCCCTCGAGAAGATCGCAAGAGGCGAGGACGACACAGAAGGCCACCCTCATCC
CCCGCCCGTGGTCACTGCTCCGCCCAGCGACGAAGATGTGTCAATGGCAGCCAAAAGGCCATATAATGATGTTGT
GGACCCTTCGCTGCCGCTCTTCCCAGCCAGCTATGAACGCACGCAACGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail