Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5065.t1
Gene name
Locationscaffold_11:469017..471575
Strand+
Gene length (bp)2558
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 4.3E-13 87 245
PF13649 Methyltransf_25 Methyltransferase domain 3.9E-07 95 184

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 18.82 8.55 29.08
5d_25C Five days - 25 degrees Celsius 14.94 6.28 23.60
7d_25C Seven days - 25 degrees Celsius 16.59 7.26 25.93
10d_25C Ten days - 25 degrees Celsius 18.91 8.49 29.32
7d_15C Seven days - 15 degrees Celsius 19.80 8.91 30.70
7d_30C Seven days - 30 degrees Celsius 28.26 14.15 42.37

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.535602 no
3d_25C 7d_25C 0.757026 no
3d_25C 7d_15C 0.909764 no
3d_25C 7d_30C 0.168614 no
3d_25C 10d_25C 0.992011 no
5d_25C 7d_25C 0.812944 no
5d_25C 7d_15C 0.426538 no
5d_25C 7d_30C 0.027948 yes
5d_25C 10d_25C 0.535728 no
7d_25C 7d_15C 0.645143 no
7d_25C 7d_30C 0.068260 no
7d_25C 10d_25C 0.755778 no
7d_15C 7d_30C 0.244248 no
7d_15C 10d_25C 0.921148 no
7d_30C 10d_25C 0.189996 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5065.t1
MKEKKWTKSRWTPISTLWPLAMTWIIMTFSPSAIARGRLENGRRYQAIKEDDYWGPSDEQQFEAFEIGHLMFLVL
DHDQPNPLFRSPIGASPKNILDIGTGQGSWAIDVADRYPLATVRGVDLFPPPVLWMPPNCIFEVDDVLREWTWRE
PFDFIHMRLMYGAFPPDGWQKLYKQAYDALEPGGWIEQIELDVRVYSDDGTLTKEHQLYGWGDIFIGCSERAGRS
LRTHETMRSAIEEAGFVDVHEEKYKIPLGCWARDNILKEAGHLQHSHWNAALEGWAMWLLTHFGEPEPWSKEEVQ
VFLVKVRKELNNPRIHAYEPANRVWARKPLKEELKVEEVKIKAEKSA*
Coding >Pro_DTO377G3_2|g5065.t1
ATGAAGGAAAAAAAATGGACCAAATCGCGGTGGACCCCGATTTCTACTCTATGGCCACTGGCTATGACGTGGATC
ATCATGACCTTCAGTCCGTCCGCTATTGCAAGGGGACGGCTGGAAAACGGCCGAAGATACCAAGCCATCAAAGAA
GATGACTACTGGGGTCCTTCCGACGAGCAGCAATTTGAGGCATTTGAGATTGGCCACCTGATGTTTCTCGTGCTA
GATCACGATCAGCCAAATCCTCTGTTCCGCTCCCCTATCGGCGCTTCGCCTAAGAATATCTTGGACATCGGAACT
GGCCAAGGGAGTTGGGCAATTGATGTTGCCGATCGCTATCCTCTAGCTACCGTCCGCGGCGTGGATCTCTTTCCC
CCACCCGTGTTATGGATGCCCCCGAACTGCATCTTCGAGGTGGATGATGTGCTTCGCGAGTGGACATGGAGAGAG
CCGTTTGACTTTATCCACATGCGCCTCATGTATGGCGCCTTCCCTCCCGATGGATGGCAAAAGCTATACAAACAG
GCCTACGATGCCCTAGAGCCTGGTGGCTGGATCGAACAAATCGAATTAGACGTGCGAGTCTACAGCGATGACGGC
ACCTTGACGAAAGAACACCAGCTATATGGTTGGGGCGACATTTTTATCGGATGCTCCGAACGAGCAGGACGGTCA
CTCAGAACCCACGAAACAATGCGTAGCGCCATCGAGGAAGCCGGGTTCGTGGACGTGCATGAGGAAAAGTACAAG
ATTCCTCTAGGATGTTGGGCCAGGGATAATATACTGAAGGAGGCCGGACACCTCCAGCATAGCCATTGGAACGCC
GCTCTAGAGGGTTGGGCGATGTGGCTTCTCACTCACTTTGGAGAGCCAGAGCCGTGGTCAAAGGAGGAGGTGCAG
GTGTTTCTGGTTAAAGTGCGCAAGGAGCTGAACAACCCGCGTATTCACGCTTATGAGCCTGCGAATCGCGTGTGG
GCAAGAAAGCCTCTCAAGGAGGAATTGAAGGTGGAGGAAGTAAAGATCAAGGCTGAGAAATCGGCGTAA
Transcript >Pro_DTO377G3_2|g5065.t1
ATGAAGGAAAAAAAATGGACCAAATCGCGGTGGACCCCGATTTCTACTCTATGGCCACTGGCTATGACGTGGATC
ATCATGACCTTCAGTCCGTCCGCTATTGCAAGGGGACGGCTGGAAAACGGCCGAAGATACCAAGCCATCAAAGAA
GATGACTACTGGGGTCCTTCCGACGAGCAGCAATTTGAGGCATTTGAGATTGGCCACCTGATGTTTCTCGTGCTA
GATCACGATCAGCCAAATCCTCTGTTCCGCTCCCCTATCGGCGCTTCGCCTAAGAATATCTTGGACATCGGAACT
GGCCAAGGGAGTTGGGCAATTGATGTTGCCGATCGCTATCCTCTAGCTACCGTCCGCGGCGTGGATCTCTTTCCC
CCACCCGTGTTATGGATGCCCCCGAACTGCATCTTCGAGGTGGATGATGTGCTTCGCGAGTGGACATGGAGAGAG
CCGTTTGACTTTATCCACATGCGCCTCATGTATGGCGCCTTCCCTCCCGATGGATGGCAAAAGCTATACAAACAG
GCCTACGATGCCCTAGAGCCTGGTGGCTGGATCGAACAAATCGAATTAGACGTGCGAGTCTACAGCGATGACGGC
ACCTTGACGAAAGAACACCAGCTATATGGTTGGGGCGACATTTTTATCGGATGCTCCGAACGAGCAGGACGGTCA
CTCAGAACCCACGAAACAATGCGTAGCGCCATCGAGGAAGCCGGGTTCGTGGACGTGCATGAGGAAAAGTACAAG
ATTCCTCTAGGATGTTGGGCCAGGGATAATATACTGAAGGAGGCCGGACACCTCCAGCATAGCCATTGGAACGCC
GCTCTAGAGGGTTGGGCGATGTGGCTTCTCACTCACTTTGGAGAGCCAGAGCCGTGGTCAAAGGAGGAGGTGCAG
GTGTTTCTGGTTAAAGTGCGCAAGGAGCTGAACAACCCGCGTATTCACGCTTATGAGCCTGCGAATCGCGTGTGG
GCAAGAAAGCCTCTCAAGGAGGAATTGAAGGTGGAGGAAGTAAAGATCAAGGCTGAGAAATCGGCGTAA
Gene >Pro_DTO377G3_2|g5065.t1
ATGAAGGAAAAGTGAGCTGAAGAATAAGCCTTGTTTGTTGCTACTCTGTTTGCTCCATCCACACAAGAACAAATA
TCATTTTATTTACGTAAATCATGATGAAAGCCCTGGAGTATAGTCTGAGGTAGGAGGTAAAGGTATTTAGTGAGG
GAAATATCAACTGCTTTGGAGCATACAGCTTATACGCAGATGTCAAGAAAGAAACCAGTATGGTGAGATAATGGG
ACAAGGAGGCTAGGGCCAAACATAGACAAAGAGTATTAAAAGCTGTGATAGACTTAAATGTTCCTATCCGTGAAT
ATCCCAAGAGTTATATGAAGCTACATGAAAGGCATACCTACATACTAGCTATCTGTTTCGCTCACATTGCTATAT
CTTGTAGTCACGTCTCATGCCGAGGCAATACTTGATTTATATACTGAAATATCATCTATCAACATAAAACGGCTC
AAGGGACCATTGAATTTCTCTTATTGCATGGGTTATCCTTCGAAGATCTCTACTTGAGGTTGCTCCCAAGAGGGG
TATGCTCGTATCTTACCTGATTTGTGATAAGGTAGATGCAAGCTTTGAGGCCACCTATTATGGAATGAGCTTGAA
TTTGGCTCATGAGCCTTGTTTTGTGGAATACCAAGTGGGAGGATGTTGGTTTAGGGCTTGTTGTTCTGCCTGTAC
AACATACTCAGAAGTGAACATGGCTCCCGGGGTGCCGCTTTATGAGGTCCCACACGGACCAGCTGACATGGATCA
ACAGCATCCTGCCGTTCCCCTCGTACTTTTTTTATGCGAGTCCTCAACCTAGACCCAACTCGGTCATACTCTAGG
GCTGTGGCTTCGGCTCACACCCTGCTAGCTTAACGGTTGTGGATTCCCCGGGAGTTTGTTCCCGTGCTGACACTT
TTACACTCCACCCTCGTTTTCCTCCTTTTATCTTCCACAGTATTTGGAAAAGTGTCGAGAGAATGGTTAAGAAAA
TGGACCAAATCGCGGTGGTGAGTGGTAATCTCATAATCCGATATAGTCATTCTCACCTCTCACCTAGGACCCCGA
TTTCTACTCTATGGCCACTGGCTATGACGTGGATCATCATGACCTTCAGTCGTGAGTGTCACTGCAAATCATATA
TATAAGTCGAGTTCTTACCCCATCCATAGCGTCCGCTATTGCAAGGGGACGGCTGGAAAACGGCCGAAGGTCAGT
ATACTTCCAGTCTAAGATGCTTTGTAAGACTAACCCGGTATGCAGATACCAAGCCATCAAAGAAGATGACTACTG
GTTAGTTACGATGCAGCGATCTTGTTCTACATAAAGTAACAATATCAAGGGGTCCTTCCGACGAGCAGCAATTTG
AGGCATTTGAGATTGGGTAAACCACATCCCGTCCCCATACCTTTCAGAGATGTGATACTAACAAATTCAGCCACC
TGATGTTTCTCGTGCTAGATCACGATCAGCCAAATCCTCTGTTCCGCTCCCCTATCGGCGCTTCGCCTAAGGTGA
ATTTATACGGAGACCCTCGCTTAAACGCCCTGCTAACTACGGAGTATAGAATATCTTGGACATCGGAACTGGCCA
AGGGAGTTGGGCAATGTATGTCAACGGGTAGCCCTTCTTGAGAGAAAGAGAATCTCTAACAAGTCCTTAGTGATG
TTGCCGATCGCTATCCTCTAGGTATTGAATTTCTTGATTCTACTCCTTCTATTTCTGACCGAACTACCCCTGACT
GAAACTAACTAGCTACCGTCCGCGGCGTGGATCTCTTTCCCCCACCCGTGTTATGGATGCCCCCGAACTGCATCT
TCGAGGTGGATGATGTGCTTCGCGAGTGGACATGGAGAGAGCCGTTTGACTTTATCCACATGCGCCTCATGTATG
GCGCCTTCCCTCCCGATGGATGGCAAAAGCTATACAAACAGGCCTACGAGTGAGTTCCAATTCCCTACTAATCGA
CTTTCCGAGACATGGCGCCCTAATTTCTTTCATCTCTCACTAGTGCCCTAGAGCCTGGTGGCTGGATCGAACAAA
TCGAATTAGACGTGCGAGTCTACAGCGATGACGGCACCTTGACGAAAGAACACCAGCTATATGGTTGGGGCGACA
TTTTTATCGGATGCTCCGAACGAGCAGGACGGTCACTCAGAACCCACGAAACAATGCGTAGCGCCATCGAGGAAG
CCGGGTTCGTGGACGTGCATGAGGAAAAGTACAAGATTCCTCTAGGATGTTGGGCCAGGGATAATATACTGAAGG
AGGCCGGACACCTCCAGCATAGCCATTGGAACGCCGCTCTAGAGGGTTGGGCGATGTGGCTTCTCACTCACTTTG
GAGAGCCAGAGCCGTGGTCAAAGGAGGAGGTGCAGGTGTTTCTGGTTAAAGTGCGCAAGGAGCTGAACAACCCGC
GTATTCACGCTTATGAGCCTGCGTAAGTTTGCTTTCGGATCGGATCGCTGGATTTACTCATGCTGATATATTTCA
GGAATCGCGTGTGGGCAAGAAAGCCTCTCAAGGAGGAATTGAAGGTGGAGGAAGTAAAGATCAAGGCTGAGAAAT
CGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail