Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5056.t1
Gene name
Locationscaffold_11:436584..444120
Strand-
Gene length (bp)7536
Transcript length (bp)7536
Coding sequence length (bp)7536
Protein length (aa) 2512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08083 PROCN PROCN (NUC071) domain 2.0E-233 414 819
PF12134 PRP8_domainIV PRP8 domain IV core 3.6E-126 1938 2165
PF10596 U6-snRNA_bdg U6-snRNA interacting domain of PrP8 1.1E-24 1460 1525
PF10596 U6-snRNA_bdg U6-snRNA interacting domain of PrP8 1.5E-57 1658 1776
PF08082 PRO8NT PRO8NT (NUC069), PrP8 N-terminal domain 2.4E-80 67 218
PF10597 U5_2-snRNA_bdg U5-snRNA binding site 2 of PrP8 1.0E-70 1228 1361
PF08084 PROCT PROCT (NUC072) domain 2.7E-47 2388 2508
PF10598 RRM_4 RNA recognition motif of the spliceosomal PrP8 1.6E-46 1004 1094
PF05203 Hom_end_hint Hom_end-associated Hint 1.0E-07 1525 1598

GO

GO Term Description Terminal node
GO:0017070 U6 snRNA binding Yes
GO:0003723 RNA binding Yes
GO:0030623 U5 snRNA binding Yes
GO:0030908 protein splicing Yes
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0009987 cellular process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016071 mRNA metabolic process No
GO:0006508 proteolysis No
GO:0071704 organic substance metabolic process No
GO:0051604 protein maturation No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0016485 protein processing No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0043170 macromolecule metabolic process No
GO:0006396 RNA processing No
GO:0017069 snRNA binding No
GO:0008380 RNA splicing No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005488 binding No
GO:0019538 protein metabolic process No
GO:0016070 RNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0006397 mRNA processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5056.t1
MASLPPPPPPPGWSAAPPMPMAPPPPGYQPPADPNVAKFAQKKNEWLRTQRNRFGEKRKAGFVETQKADMPPEHL
RKIVRDIGDVSQKKFTNEKRSYLGALKFMPHAVLKLLENMPMPWESAREVKVLYHVNGCLTLVNETPRVIEPVFH
AQWATMWMCMRREKSDRRHFKRMRFPPFDDEEPPLSWSENIEDVEPLEPIQMELDEVEDAAVYEWFYDHRPLLDT
PHVNGPSYKKWNLSLPQMATLHRLSHQILSDVVDQNYYHMFDLNSFFTAKALNVAIPGGPRFEPLYKDIDPNDED
FSEFNAIDRIIFRAPIRTEYRVTFPFLYNTLPRSVKVAWYSHPQVVYVRTEDPNLPAFYFDPVINPISSRSVAPK
NITVSHEDEIFGPGNNEDDEFELPGDVEPFFNDEELYTSETASAIALWWAPHPFDKRSGKMVRAQDVPLVKQWYL
EHCPQGQPVKVRVSYQKMLKTYVLNELHKGTPKAQSKQNLMKTLKTTKFFQQTSIDWVEAGLQVCRQGFNMLNLL
IHRKNLTYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRLTKLIVDAQVQYRLGNIDAFQLADGILYAF
NHVGQLTGMYRYKYKLMHQIRSCKDLKHLIYYRFNSGPVGKGPGCGFWAPAWRVWLFFMRGIIPLLERWLGNLLS
RQFEGRHSKGVAKTVTKQRVESHFDLELRASVMADLMDMMPEGIKQNKVNVVLQHLSEAWRCWKSNIPWKVPGLP
APIENIILRYVKSKADWWISVAHYNRERIRRGATVDKTVAKKNLGRLTRLWLKSEQERQHNYLKDGPYVSSEEAV
AIYTTMVHWLESRKFSPIPFPSVSYKHDTKILILALERLRESYSVKGRLNQTQREELALIEQAYDSPGTTLARIK
RFLLTQRAFKEVKIDMNDNYNNINPVYDIEPIEKITDAYLDQYLWYQAEQRHLFPAWIKPSDSEVPPLLTYKWTQ
GINNLSNVWETAEGETNVMIETELSKVYEKIDITLLNRLLRLIMDHNLADYITSKNNVQLSYKDMNHTNSYGLIR
GLQFSGFVFQYYGLMIDLLLLGLQRASEMAGPPGSPNDFLQFRDRATETRHPIRLYTRYVDKIWVFFRFQADDSR
DLIQRFLTENPDPNFENVIGYKNKKCWPRDCRMRLMRHDVNLGRAVFWDMKNRLPRSITTIDWDDTFASVYSKDN
PNLLFSMNGFEVRILPKMRNMNEEFSVKDSVWSLVDNSTKERTAHAFLQVTEEDVQKFNNRIRQILMSSGSTTFT
KIANKWNTALIALFTYYREAAVSTVNLLDTIVKCETKIQTRVKIGLNSKMPSRFPPAVFYTPKELGGLGMISGSH
ILIPTSDKRWSKQTDTGITHFRAGMSHDEETLIPNIFRYIIPWEAEFIDSQRVWMEYSQKRMEAQQQNRRLTLED
LEDSWDRGLPRINTLFQKDRSTLSFDKGFRLRAEFKQYQLMKSNPFWWTSQRHDGKLWNLNAYRTDVIQALGGVE
TILEHTLFKATAFPSWEGLFWEKACLAKGTRLLRYDGTEINVEDVREGDQLLGPDREPRRAFNIVNGIDRLYRVK
IGGEKEDLVVTPNHILVLHREGASNGPKKQTVEITAAEFAALPTEERNMYSAFTSPRVEQSAESSSPQIHSFKIE
HISLESEKTEWAGFRVDKDQLYLRHDYLVLHNSGFEESMKFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYV
GFQVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVLDQELEQLGIEAVQKETIHPRKSYKMNS
SCADILLFATNKWNVTRPSLVFDTKDVYEPTTTNKFWIDVQLRYGDYDSHDIERYVRAKYLDYTTDSMSIYPSAT
GLMIGVDLAYNLFSAYGQYFPGLKTLVQQAMAKIMKANPALYVLRERIRKGLQLYASESSQEFLNSQNYSELFSP
QIQLFIDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALI
RSLPVEEQPKQLIVTRKGLLDPLEVHLLDFPNISIRASELQLPFQAAMKVEKLADMILRATEPQMVLFNLYDEWL
KSISPYTAFSRLILILRALHVNIDKAKIILRPDKTVITQEHHIWPSLSDEDWIKVEVQLRDLILNDYGKKNNVNV
QSLTSSEVRDIILGMEISAPSLQRQQAAEIEKQQEEQKQLTAVTTKTQNARGEDIIVTTTSQYEQQSFASKTEWR
TRAIATSNLRTRSNNIYVSSDDIRDDGYTYIMPKNVLKRFITIADLRVQVTGYIYGSSPPDNDQVKEVRTIVMIP
QVGNTRDVQLPHQLPQHDYLQNLEPLGIIHTVSGNEPPYMSAADVTHHARLMNAHPSWDKRTVTMTVSFTPGSVS
LAAWGLTPAGYKWGAENKDTTSDQPQGFSTNMGEKCQLLLSDKIRGYFLVPEDNVWNYSFMGSSFGSVEKRPIYV
KIDTPLKFYDDQHRPLHFQNFAELEDIWVDRADNFA*
Coding >Pro_DTO377G3_2|g5056.t1
ATGGCCTCATTGCCTCCCCCTCCTCCACCTCCGGGATGGAGTGCAGCTCCTCCTATGCCGATGGCGCCGCCGCCC
CCGGGCTACCAACCACCAGCCGACCCGAATGTCGCAAAATTTGCGCAGAAGAAAAATGAATGGCTGCGCACGCAA
CGCAATCGGTTCGGCGAGAAGCGCAAAGCAGGATTTGTCGAAACACAAAAGGCTGATATGCCACCGGAGCATCTG
CGAAAGATTGTACGAGATATTGGCGATGTTTCTCAGAAGAAATTCACAAACGAGAAGCGGAGTTACCTCGGTGCG
CTCAAGTTCATGCCACATGCCGTCCTCAAGCTGTTGGAAAATATGCCCATGCCTTGGGAGTCAGCAAGAGAAGTT
AAGGTGCTTTATCACGTCAACGGATGCCTGACTCTAGTAAATGAGACGCCGCGTGTCATCGAGCCCGTTTTCCAC
GCCCAATGGGCAACGATGTGGATGTGCATGCGTCGGGAGAAGAGTGACCGGAGACACTTCAAGCGGATGCGTTTC
CCCCCATTTGACGACGAGGAACCACCTCTTTCGTGGTCCGAAAATATTGAAGATGTTGAACCGTTGGAGCCCATT
CAGATGGAACTGGATGAGGTCGAAGATGCGGCAGTTTATGAATGGTTCTACGACCACCGTCCCCTGCTTGATACC
CCCCACGTGAATGGACCGAGTTACAAGAAGTGGAATTTGTCTCTTCCCCAGATGGCGACTCTCCATCGGCTCAGT
CATCAGATTCTGAGTGATGTTGTTGACCAGAACTACTACCACATGTTCGACTTGAACAGCTTCTTCACAGCTAAG
GCCCTCAACGTGGCCATTCCTGGTGGACCCCGCTTCGAACCTTTGTATAAGGATATCGATCCTAATGACGAAGAT
TTCAGCGAGTTCAACGCCATTGACCGTATCATCTTCCGTGCCCCGATTCGAACCGAGTACCGGGTCACCTTCCCC
TTTCTCTACAACACCCTGCCTCGAAGCGTCAAGGTCGCTTGGTACTCCCATCCCCAAGTGGTCTACGTTCGCACC
GAGGATCCAAACCTGCCGGCTTTCTATTTCGATCCCGTCATCAACCCGATCTCCTCCCGCTCGGTCGCACCTAAA
AATATCACCGTCAGCCACGAAGACGAAATATTTGGGCCTGGCAATAATGAAGACGACGAATTTGAGCTTCCGGGT
GACGTTGAGCCCTTCTTTAACGACGAAGAACTCTACACATCCGAAACCGCGTCCGCCATCGCCCTGTGGTGGGCC
CCTCACCCATTCGATAAGAGATCTGGCAAGATGGTTCGTGCACAGGATGTGCCGTTGGTCAAGCAATGGTACTTG
GAGCACTGTCCACAGGGTCAGCCAGTCAAAGTCCGAGTCTCGTACCAGAAGATGCTGAAGACCTACGTTCTCAAC
GAATTGCACAAGGGCACCCCCAAGGCCCAGAGTAAGCAGAATCTCATGAAGACTCTCAAAACGACTAAGTTCTTC
CAGCAAACATCGATCGATTGGGTTGAGGCCGGTTTGCAAGTTTGTCGCCAGGGTTTCAACATGCTGAACCTGCTG
ATTCACCGCAAGAATTTGACATATCTCCACCTTGATTACAACTTCAATCTAAAGCCTGTCAAGACATTGACAACT
AAGGAGCGTAAGAAGTCTCGCTTCGGAAATGCTTTCCACTTGATGCGTGAAATTCTCCGGTTGACTAAGCTCATC
GTCGATGCCCAAGTCCAATATCGTCTGGGTAACATAGACGCCTTCCAGCTCGCAGATGGTATTCTTTATGCCTTC
AACCACGTGGGCCAGCTTACCGGTATGTATCGGTACAAGTATAAGCTTATGCACCAGATTCGTTCCTGCAAGGAT
CTGAAGCATTTGATTTACTACCGATTCAACTCCGGCCCCGTTGGTAAGGGCCCTGGATGTGGTTTCTGGGCGCCC
GCTTGGCGAGTCTGGCTTTTCTTCATGCGTGGCATCATTCCCCTGCTTGAGCGCTGGCTTGGAAATCTGCTTTCC
CGTCAGTTTGAGGGTCGTCACAGCAAGGGTGTTGCCAAGACAGTTACCAAGCAGCGTGTGGAATCTCATTTCGAT
CTCGAGTTGCGTGCCTCGGTCATGGCCGATCTTATGGACATGATGCCTGAGGGTATTAAGCAAAACAAGGTCAAC
GTGGTTTTGCAACATCTATCAGAGGCCTGGAGATGTTGGAAGAGTAACATTCCTTGGAAGGTTCCCGGCTTGCCC
GCACCAATTGAGAACATCATTCTTCGTTACGTCAAAAGCAAGGCCGACTGGTGGATCTCTGTCGCTCATTACAAC
CGAGAGAGAATTCGCCGCGGTGCCACAGTTGACAAGACTGTAGCAAAGAAGAACCTTGGTCGACTCACGCGTCTC
TGGCTCAAGTCTGAGCAAGAACGTCAGCACAACTATTTGAAGGACGGCCCTTACGTTTCCTCTGAAGAGGCGGTT
GCAATCTACACTACCATGGTTCATTGGTTGGAGTCTCGCAAGTTCTCCCCAATTCCCTTCCCCAGTGTTTCCTAT
AAGCACGACACCAAAATTCTGATTCTTGCACTCGAGCGGCTGCGCGAGTCGTACTCTGTTAAAGGAAGACTGAAT
CAAACCCAGCGAGAGGAATTGGCTCTTATCGAACAGGCCTATGATTCCCCTGGCACAACCTTGGCGAGAATTAAG
CGATTCCTTCTGACACAGAGAGCGTTCAAGGAGGTCAAGATTGACATGAACGATAACTACAACAACATCAATCCT
GTCTACGATATTGAGCCCATCGAAAAGATCACCGACGCTTATCTGGATCAATACCTTTGGTACCAAGCGGAGCAG
CGCCATCTCTTCCCCGCTTGGATCAAACCTTCCGACTCTGAGGTTCCCCCTTTACTCACATATAAGTGGACACAA
GGCATCAACAATTTGTCCAATGTCTGGGAGACTGCCGAAGGCGAGACGAACGTGATGATCGAGACTGAGCTGTCT
AAGGTCTATGAGAAGATCGATATCACTCTGCTGAACCGGCTGCTCCGTTTGATCATGGATCACAATCTGGCTGAC
TACATTACCTCAAAGAACAATGTTCAACTCAGCTACAAGGATATGAATCACACCAATAGCTATGGACTGATTCGC
GGTCTACAATTCTCGGGCTTCGTGTTCCAGTACTACGGCTTGATGATCGACCTGTTGCTCCTTGGCTTGCAGCGA
GCCAGTGAAATGGCCGGCCCTCCCGGAAGTCCCAACGATTTCTTGCAATTTAGAGATCGTGCCACTGAGACAAGG
CACCCCATCCGCCTGTATACCCGTTACGTTGATAAGATCTGGGTATTCTTCCGATTCCAGGCTGACGACTCCCGT
GACCTGATCCAGCGGTTCTTGACCGAGAATCCTGATCCTAACTTTGAGAACGTCATCGGCTACAAGAATAAAAAG
TGCTGGCCTCGCGATTGTCGCATGCGCTTGATGCGTCACGATGTCAACCTTGGTCGTGCTGTTTTCTGGGACATG
AAGAACCGCCTCCCAAGATCCATCACCACCATTGACTGGGATGATACATTCGCTAGCGTGTACAGTAAAGACAAC
CCTAACTTGCTGTTCTCGATGAATGGATTCGAAGTCCGTATTCTCCCCAAGATGCGGAATATGAACGAGGAGTTC
TCAGTCAAGGACAGTGTCTGGTCCCTGGTTGATAACTCTACCAAGGAACGGACGGCACATGCCTTCCTCCAGGTC
ACCGAAGAGGATGTCCAAAAGTTCAATAACCGTATCCGACAAATTCTGATGTCCTCTGGTTCGACCACATTCACC
AAGATTGCCAACAAGTGGAACACTGCTCTAATTGCTCTTTTCACTTACTATCGCGAGGCTGCTGTCTCGACTGTC
AACCTTCTCGATACTATCGTGAAGTGTGAAACGAAGATTCAGACTCGAGTCAAGATTGGTCTGAACTCTAAGATG
CCGTCTCGTTTCCCCCCGGCGGTCTTCTACACCCCTAAGGAGCTTGGAGGTCTTGGTATGATCTCAGGATCCCAT
ATCCTCATCCCAACCAGTGATAAGCGCTGGTCTAAGCAGACTGACACTGGTATTACTCACTTCCGAGCGGGTATG
TCTCATGACGAGGAAACATTGATTCCGAATATCTTCCGATACATCATTCCCTGGGAGGCCGAGTTTATTGACTCT
CAGCGTGTTTGGATGGAATACTCGCAGAAGCGTATGGAAGCCCAGCAGCAGAACCGCCGTCTCACGTTGGAAGAT
TTAGAGGACAGCTGGGATCGTGGTCTTCCCCGTATTAACACGCTCTTCCAGAAGGATCGAAGCACTCTCAGCTTC
GACAAGGGATTCCGACTCCGCGCTGAGTTCAAGCAATACCAGCTGATGAAGAGCAATCCGTTCTGGTGGACTAGC
CAGCGACACGACGGTAAGCTCTGGAACCTCAATGCCTACCGCACTGATGTTATCCAAGCATTGGGTGGTGTCGAA
ACAATTCTCGAGCACACCTTGTTCAAGGCGACAGCTTTCCCATCCTGGGAAGGTCTGTTCTGGGAAAAAGCGTGT
CTTGCCAAGGGAACTCGTCTCTTGCGATACGACGGGACCGAGATCAATGTCGAGGACGTGCGCGAAGGTGACCAA
CTTCTGGGCCCCGACAGAGAGCCTCGCCGTGCATTCAACATAGTGAATGGCATCGACCGCCTGTACCGCGTCAAA
ATCGGCGGTGAGAAAGAAGATCTCGTGGTGACGCCGAATCATATTCTAGTGCTCCATCGGGAGGGAGCCTCCAAT
GGTCCCAAAAAGCAAACCGTGGAGATCACTGCTGCCGAGTTCGCTGCCCTTCCTACTGAGGAAAGAAATATGTAC
AGTGCCTTTACATCTCCTAGGGTTGAGCAGAGCGCCGAATCTTCATCTCCTCAAATTCACAGTTTCAAGATCGAG
CACATTAGCCTCGAATCTGAGAAGACAGAGTGGGCTGGTTTCCGAGTCGACAAAGATCAGCTTTACCTGCGCCAT
GACTACCTTGTTCTGCACAACAGTGGTTTCGAAGAAAGTATGAAATTCAAGAAGCTCACCAACGCTCAGCGGTCC
GGTTTGAACCAGATTCCCAACCGTCGATTCACTCTCTGGTGGTCGCCGACTATCAACCGCGCCAACGTCTACGTC
GGTTTCCAGGTGCAACTTGATTTGACTGGTATCTTCTTACACGGCAAAATTCCCACCCTGAAAATTTCGTTGATT
CAGATTTTCCGTGCCCATCTGTGGCAGAAGATTCACGAATCGGTGGTCATGGATTTGTGTCAAGTCCTGGATCAG
GAATTGGAACAGCTTGGCATCGAGGCCGTTCAAAAAGAGACTATTCACCCACGTAAATCTTACAAGATGAACAGC
TCTTGTGCGGATATCTTGCTCTTCGCGACCAACAAGTGGAATGTCACCCGACCTTCGCTTGTGTTCGATACCAAG
GACGTCTACGAGCCGACCACGACAAACAAGTTCTGGATCGACGTGCAGCTCAGATATGGTGACTACGATTCTCAC
GACATTGAACGTTACGTCCGTGCTAAGTACCTCGATTACACCACGGACAGCATGAGTATCTATCCTTCCGCCACT
GGATTAATGATTGGTGTTGATCTTGCATACAACCTCTTCTCGGCTTACGGGCAGTACTTCCCAGGCCTGAAGACT
CTGGTTCAGCAAGCTATGGCTAAAATCATGAAAGCTAACCCAGCTTTGTATGTCTTGCGTGAGCGTATCCGCAAG
GGTCTCCAGCTGTATGCCTCGGAGAGCAGTCAGGAGTTCCTCAATTCTCAGAACTACTCCGAGCTCTTCAGTCCG
CAGATTCAGCTCTTTATCGACGACACTAACGTCTATCGCGTCACGATCCATAAGACATTTGAGGGTAACTTGACG
ACAAAGCCCATTAACGGTGCAATCTTCATTTTCAACCCTCGAACTGGACAATTGTTCCTGAAGATTATCCACACC
AGTGTCTGGGCAGGCCAAAAGCGTCTGGGTCAATTGGCCAAGTGGAAGACAGCCGAAGAAGTTGCAGCTCTCATT
CGGTCTCTCCCCGTTGAAGAGCAACCGAAGCAGCTCATTGTCACCCGCAAGGGTCTTCTTGACCCTCTCGAGGTC
CATCTGCTCGATTTCCCCAACATCTCTATTCGTGCCTCTGAGCTCCAGCTGCCCTTCCAGGCCGCCATGAAGGTT
GAGAAACTAGCCGATATGATTCTCCGTGCCACTGAACCTCAGATGGTACTCTTCAACTTGTATGATGAGTGGCTC
AAGTCTATCTCCCCGTACACTGCCTTTTCTCGACTCATTCTCATTCTTCGGGCTCTTCACGTCAATATCGACAAA
GCCAAGATCATTCTTCGGCCCGATAAGACCGTTATCACTCAAGAACATCACATCTGGCCATCCCTGTCTGATGAG
GACTGGATCAAGGTCGAAGTGCAATTGCGTGATCTGATCTTGAATGACTATGGCAAGAAGAACAATGTCAACGTG
CAGAGCTTGACCAGTAGCGAAGTTCGTGATATTATCCTGGGTATGGAGATTAGTGCGCCTTCTCTGCAGCGACAG
CAGGCAGCGGAGATCGAGAAGCAGCAAGAAGAGCAGAAGCAGCTCACTGCTGTGACTACCAAGACCCAGAACGCT
CGTGGTGAGGACATTATCGTCACCACTACATCTCAGTACGAACAGCAATCATTTGCATCTAAGACAGAGTGGCGT
ACTCGTGCAATTGCGACCTCCAATCTCCGGACGAGGTCCAACAACATCTATGTCTCCTCTGATGACATCCGGGAC
GATGGCTACACCTACATCATGCCCAAGAACGTCCTCAAGCGATTCATCACCATCGCTGATCTCCGAGTGCAGGTC
ACGGGCTACATCTACGGTAGCTCCCCCCCAGACAATGACCAGGTCAAGGAGGTCCGCACCATTGTCATGATTCCA
CAAGTGGGTAACACCCGAGACGTCCAGCTGCCACACCAGTTGCCGCAGCACGACTATCTCCAAAATCTAGAGCCG
CTCGGTATTATCCATACGGTTTCTGGCAATGAGCCGCCGTACATGTCTGCGGCAGATGTCACACATCACGCACGT
CTCATGAACGCCCATCCTTCGTGGGATAAGAGGACCGTGACCATGACTGTTTCTTTTACTCCTGGATCCGTTTCA
CTTGCCGCCTGGGGTCTCACTCCGGCGGGCTACAAGTGGGGCGCAGAGAACAAGGACACAACCTCGGATCAGCCA
CAAGGCTTCTCCACCAACATGGGTGAGAAGTGTCAGCTGCTTCTCAGTGACAAGATCCGCGGCTATTTCCTTGTG
CCCGAGGATAACGTCTGGAACTATAGCTTTATGGGCAGCTCTTTTGGTAGCGTGGAGAAGAGACCTATCTACGTC
AAGATTGATACCCCTCTTAAGTTCTACGATGACCAACACCGTCCCCTGCACTTCCAGAACTTCGCCGAGCTCGAG
GACATCTGGGTTGACCGGGCTGACAACTTTGCGTAA
Transcript >Pro_DTO377G3_2|g5056.t1
ATGGCCTCATTGCCTCCCCCTCCTCCACCTCCGGGATGGAGTGCAGCTCCTCCTATGCCGATGGCGCCGCCGCCC
CCGGGCTACCAACCACCAGCCGACCCGAATGTCGCAAAATTTGCGCAGAAGAAAAATGAATGGCTGCGCACGCAA
CGCAATCGGTTCGGCGAGAAGCGCAAAGCAGGATTTGTCGAAACACAAAAGGCTGATATGCCACCGGAGCATCTG
CGAAAGATTGTACGAGATATTGGCGATGTTTCTCAGAAGAAATTCACAAACGAGAAGCGGAGTTACCTCGGTGCG
CTCAAGTTCATGCCACATGCCGTCCTCAAGCTGTTGGAAAATATGCCCATGCCTTGGGAGTCAGCAAGAGAAGTT
AAGGTGCTTTATCACGTCAACGGATGCCTGACTCTAGTAAATGAGACGCCGCGTGTCATCGAGCCCGTTTTCCAC
GCCCAATGGGCAACGATGTGGATGTGCATGCGTCGGGAGAAGAGTGACCGGAGACACTTCAAGCGGATGCGTTTC
CCCCCATTTGACGACGAGGAACCACCTCTTTCGTGGTCCGAAAATATTGAAGATGTTGAACCGTTGGAGCCCATT
CAGATGGAACTGGATGAGGTCGAAGATGCGGCAGTTTATGAATGGTTCTACGACCACCGTCCCCTGCTTGATACC
CCCCACGTGAATGGACCGAGTTACAAGAAGTGGAATTTGTCTCTTCCCCAGATGGCGACTCTCCATCGGCTCAGT
CATCAGATTCTGAGTGATGTTGTTGACCAGAACTACTACCACATGTTCGACTTGAACAGCTTCTTCACAGCTAAG
GCCCTCAACGTGGCCATTCCTGGTGGACCCCGCTTCGAACCTTTGTATAAGGATATCGATCCTAATGACGAAGAT
TTCAGCGAGTTCAACGCCATTGACCGTATCATCTTCCGTGCCCCGATTCGAACCGAGTACCGGGTCACCTTCCCC
TTTCTCTACAACACCCTGCCTCGAAGCGTCAAGGTCGCTTGGTACTCCCATCCCCAAGTGGTCTACGTTCGCACC
GAGGATCCAAACCTGCCGGCTTTCTATTTCGATCCCGTCATCAACCCGATCTCCTCCCGCTCGGTCGCACCTAAA
AATATCACCGTCAGCCACGAAGACGAAATATTTGGGCCTGGCAATAATGAAGACGACGAATTTGAGCTTCCGGGT
GACGTTGAGCCCTTCTTTAACGACGAAGAACTCTACACATCCGAAACCGCGTCCGCCATCGCCCTGTGGTGGGCC
CCTCACCCATTCGATAAGAGATCTGGCAAGATGGTTCGTGCACAGGATGTGCCGTTGGTCAAGCAATGGTACTTG
GAGCACTGTCCACAGGGTCAGCCAGTCAAAGTCCGAGTCTCGTACCAGAAGATGCTGAAGACCTACGTTCTCAAC
GAATTGCACAAGGGCACCCCCAAGGCCCAGAGTAAGCAGAATCTCATGAAGACTCTCAAAACGACTAAGTTCTTC
CAGCAAACATCGATCGATTGGGTTGAGGCCGGTTTGCAAGTTTGTCGCCAGGGTTTCAACATGCTGAACCTGCTG
ATTCACCGCAAGAATTTGACATATCTCCACCTTGATTACAACTTCAATCTAAAGCCTGTCAAGACATTGACAACT
AAGGAGCGTAAGAAGTCTCGCTTCGGAAATGCTTTCCACTTGATGCGTGAAATTCTCCGGTTGACTAAGCTCATC
GTCGATGCCCAAGTCCAATATCGTCTGGGTAACATAGACGCCTTCCAGCTCGCAGATGGTATTCTTTATGCCTTC
AACCACGTGGGCCAGCTTACCGGTATGTATCGGTACAAGTATAAGCTTATGCACCAGATTCGTTCCTGCAAGGAT
CTGAAGCATTTGATTTACTACCGATTCAACTCCGGCCCCGTTGGTAAGGGCCCTGGATGTGGTTTCTGGGCGCCC
GCTTGGCGAGTCTGGCTTTTCTTCATGCGTGGCATCATTCCCCTGCTTGAGCGCTGGCTTGGAAATCTGCTTTCC
CGTCAGTTTGAGGGTCGTCACAGCAAGGGTGTTGCCAAGACAGTTACCAAGCAGCGTGTGGAATCTCATTTCGAT
CTCGAGTTGCGTGCCTCGGTCATGGCCGATCTTATGGACATGATGCCTGAGGGTATTAAGCAAAACAAGGTCAAC
GTGGTTTTGCAACATCTATCAGAGGCCTGGAGATGTTGGAAGAGTAACATTCCTTGGAAGGTTCCCGGCTTGCCC
GCACCAATTGAGAACATCATTCTTCGTTACGTCAAAAGCAAGGCCGACTGGTGGATCTCTGTCGCTCATTACAAC
CGAGAGAGAATTCGCCGCGGTGCCACAGTTGACAAGACTGTAGCAAAGAAGAACCTTGGTCGACTCACGCGTCTC
TGGCTCAAGTCTGAGCAAGAACGTCAGCACAACTATTTGAAGGACGGCCCTTACGTTTCCTCTGAAGAGGCGGTT
GCAATCTACACTACCATGGTTCATTGGTTGGAGTCTCGCAAGTTCTCCCCAATTCCCTTCCCCAGTGTTTCCTAT
AAGCACGACACCAAAATTCTGATTCTTGCACTCGAGCGGCTGCGCGAGTCGTACTCTGTTAAAGGAAGACTGAAT
CAAACCCAGCGAGAGGAATTGGCTCTTATCGAACAGGCCTATGATTCCCCTGGCACAACCTTGGCGAGAATTAAG
CGATTCCTTCTGACACAGAGAGCGTTCAAGGAGGTCAAGATTGACATGAACGATAACTACAACAACATCAATCCT
GTCTACGATATTGAGCCCATCGAAAAGATCACCGACGCTTATCTGGATCAATACCTTTGGTACCAAGCGGAGCAG
CGCCATCTCTTCCCCGCTTGGATCAAACCTTCCGACTCTGAGGTTCCCCCTTTACTCACATATAAGTGGACACAA
GGCATCAACAATTTGTCCAATGTCTGGGAGACTGCCGAAGGCGAGACGAACGTGATGATCGAGACTGAGCTGTCT
AAGGTCTATGAGAAGATCGATATCACTCTGCTGAACCGGCTGCTCCGTTTGATCATGGATCACAATCTGGCTGAC
TACATTACCTCAAAGAACAATGTTCAACTCAGCTACAAGGATATGAATCACACCAATAGCTATGGACTGATTCGC
GGTCTACAATTCTCGGGCTTCGTGTTCCAGTACTACGGCTTGATGATCGACCTGTTGCTCCTTGGCTTGCAGCGA
GCCAGTGAAATGGCCGGCCCTCCCGGAAGTCCCAACGATTTCTTGCAATTTAGAGATCGTGCCACTGAGACAAGG
CACCCCATCCGCCTGTATACCCGTTACGTTGATAAGATCTGGGTATTCTTCCGATTCCAGGCTGACGACTCCCGT
GACCTGATCCAGCGGTTCTTGACCGAGAATCCTGATCCTAACTTTGAGAACGTCATCGGCTACAAGAATAAAAAG
TGCTGGCCTCGCGATTGTCGCATGCGCTTGATGCGTCACGATGTCAACCTTGGTCGTGCTGTTTTCTGGGACATG
AAGAACCGCCTCCCAAGATCCATCACCACCATTGACTGGGATGATACATTCGCTAGCGTGTACAGTAAAGACAAC
CCTAACTTGCTGTTCTCGATGAATGGATTCGAAGTCCGTATTCTCCCCAAGATGCGGAATATGAACGAGGAGTTC
TCAGTCAAGGACAGTGTCTGGTCCCTGGTTGATAACTCTACCAAGGAACGGACGGCACATGCCTTCCTCCAGGTC
ACCGAAGAGGATGTCCAAAAGTTCAATAACCGTATCCGACAAATTCTGATGTCCTCTGGTTCGACCACATTCACC
AAGATTGCCAACAAGTGGAACACTGCTCTAATTGCTCTTTTCACTTACTATCGCGAGGCTGCTGTCTCGACTGTC
AACCTTCTCGATACTATCGTGAAGTGTGAAACGAAGATTCAGACTCGAGTCAAGATTGGTCTGAACTCTAAGATG
CCGTCTCGTTTCCCCCCGGCGGTCTTCTACACCCCTAAGGAGCTTGGAGGTCTTGGTATGATCTCAGGATCCCAT
ATCCTCATCCCAACCAGTGATAAGCGCTGGTCTAAGCAGACTGACACTGGTATTACTCACTTCCGAGCGGGTATG
TCTCATGACGAGGAAACATTGATTCCGAATATCTTCCGATACATCATTCCCTGGGAGGCCGAGTTTATTGACTCT
CAGCGTGTTTGGATGGAATACTCGCAGAAGCGTATGGAAGCCCAGCAGCAGAACCGCCGTCTCACGTTGGAAGAT
TTAGAGGACAGCTGGGATCGTGGTCTTCCCCGTATTAACACGCTCTTCCAGAAGGATCGAAGCACTCTCAGCTTC
GACAAGGGATTCCGACTCCGCGCTGAGTTCAAGCAATACCAGCTGATGAAGAGCAATCCGTTCTGGTGGACTAGC
CAGCGACACGACGGTAAGCTCTGGAACCTCAATGCCTACCGCACTGATGTTATCCAAGCATTGGGTGGTGTCGAA
ACAATTCTCGAGCACACCTTGTTCAAGGCGACAGCTTTCCCATCCTGGGAAGGTCTGTTCTGGGAAAAAGCGTGT
CTTGCCAAGGGAACTCGTCTCTTGCGATACGACGGGACCGAGATCAATGTCGAGGACGTGCGCGAAGGTGACCAA
CTTCTGGGCCCCGACAGAGAGCCTCGCCGTGCATTCAACATAGTGAATGGCATCGACCGCCTGTACCGCGTCAAA
ATCGGCGGTGAGAAAGAAGATCTCGTGGTGACGCCGAATCATATTCTAGTGCTCCATCGGGAGGGAGCCTCCAAT
GGTCCCAAAAAGCAAACCGTGGAGATCACTGCTGCCGAGTTCGCTGCCCTTCCTACTGAGGAAAGAAATATGTAC
AGTGCCTTTACATCTCCTAGGGTTGAGCAGAGCGCCGAATCTTCATCTCCTCAAATTCACAGTTTCAAGATCGAG
CACATTAGCCTCGAATCTGAGAAGACAGAGTGGGCTGGTTTCCGAGTCGACAAAGATCAGCTTTACCTGCGCCAT
GACTACCTTGTTCTGCACAACAGTGGTTTCGAAGAAAGTATGAAATTCAAGAAGCTCACCAACGCTCAGCGGTCC
GGTTTGAACCAGATTCCCAACCGTCGATTCACTCTCTGGTGGTCGCCGACTATCAACCGCGCCAACGTCTACGTC
GGTTTCCAGGTGCAACTTGATTTGACTGGTATCTTCTTACACGGCAAAATTCCCACCCTGAAAATTTCGTTGATT
CAGATTTTCCGTGCCCATCTGTGGCAGAAGATTCACGAATCGGTGGTCATGGATTTGTGTCAAGTCCTGGATCAG
GAATTGGAACAGCTTGGCATCGAGGCCGTTCAAAAAGAGACTATTCACCCACGTAAATCTTACAAGATGAACAGC
TCTTGTGCGGATATCTTGCTCTTCGCGACCAACAAGTGGAATGTCACCCGACCTTCGCTTGTGTTCGATACCAAG
GACGTCTACGAGCCGACCACGACAAACAAGTTCTGGATCGACGTGCAGCTCAGATATGGTGACTACGATTCTCAC
GACATTGAACGTTACGTCCGTGCTAAGTACCTCGATTACACCACGGACAGCATGAGTATCTATCCTTCCGCCACT
GGATTAATGATTGGTGTTGATCTTGCATACAACCTCTTCTCGGCTTACGGGCAGTACTTCCCAGGCCTGAAGACT
CTGGTTCAGCAAGCTATGGCTAAAATCATGAAAGCTAACCCAGCTTTGTATGTCTTGCGTGAGCGTATCCGCAAG
GGTCTCCAGCTGTATGCCTCGGAGAGCAGTCAGGAGTTCCTCAATTCTCAGAACTACTCCGAGCTCTTCAGTCCG
CAGATTCAGCTCTTTATCGACGACACTAACGTCTATCGCGTCACGATCCATAAGACATTTGAGGGTAACTTGACG
ACAAAGCCCATTAACGGTGCAATCTTCATTTTCAACCCTCGAACTGGACAATTGTTCCTGAAGATTATCCACACC
AGTGTCTGGGCAGGCCAAAAGCGTCTGGGTCAATTGGCCAAGTGGAAGACAGCCGAAGAAGTTGCAGCTCTCATT
CGGTCTCTCCCCGTTGAAGAGCAACCGAAGCAGCTCATTGTCACCCGCAAGGGTCTTCTTGACCCTCTCGAGGTC
CATCTGCTCGATTTCCCCAACATCTCTATTCGTGCCTCTGAGCTCCAGCTGCCCTTCCAGGCCGCCATGAAGGTT
GAGAAACTAGCCGATATGATTCTCCGTGCCACTGAACCTCAGATGGTACTCTTCAACTTGTATGATGAGTGGCTC
AAGTCTATCTCCCCGTACACTGCCTTTTCTCGACTCATTCTCATTCTTCGGGCTCTTCACGTCAATATCGACAAA
GCCAAGATCATTCTTCGGCCCGATAAGACCGTTATCACTCAAGAACATCACATCTGGCCATCCCTGTCTGATGAG
GACTGGATCAAGGTCGAAGTGCAATTGCGTGATCTGATCTTGAATGACTATGGCAAGAAGAACAATGTCAACGTG
CAGAGCTTGACCAGTAGCGAAGTTCGTGATATTATCCTGGGTATGGAGATTAGTGCGCCTTCTCTGCAGCGACAG
CAGGCAGCGGAGATCGAGAAGCAGCAAGAAGAGCAGAAGCAGCTCACTGCTGTGACTACCAAGACCCAGAACGCT
CGTGGTGAGGACATTATCGTCACCACTACATCTCAGTACGAACAGCAATCATTTGCATCTAAGACAGAGTGGCGT
ACTCGTGCAATTGCGACCTCCAATCTCCGGACGAGGTCCAACAACATCTATGTCTCCTCTGATGACATCCGGGAC
GATGGCTACACCTACATCATGCCCAAGAACGTCCTCAAGCGATTCATCACCATCGCTGATCTCCGAGTGCAGGTC
ACGGGCTACATCTACGGTAGCTCCCCCCCAGACAATGACCAGGTCAAGGAGGTCCGCACCATTGTCATGATTCCA
CAAGTGGGTAACACCCGAGACGTCCAGCTGCCACACCAGTTGCCGCAGCACGACTATCTCCAAAATCTAGAGCCG
CTCGGTATTATCCATACGGTTTCTGGCAATGAGCCGCCGTACATGTCTGCGGCAGATGTCACACATCACGCACGT
CTCATGAACGCCCATCCTTCGTGGGATAAGAGGACCGTGACCATGACTGTTTCTTTTACTCCTGGATCCGTTTCA
CTTGCCGCCTGGGGTCTCACTCCGGCGGGCTACAAGTGGGGCGCAGAGAACAAGGACACAACCTCGGATCAGCCA
CAAGGCTTCTCCACCAACATGGGTGAGAAGTGTCAGCTGCTTCTCAGTGACAAGATCCGCGGCTATTTCCTTGTG
CCCGAGGATAACGTCTGGAACTATAGCTTTATGGGCAGCTCTTTTGGTAGCGTGGAGAAGAGACCTATCTACGTC
AAGATTGATACCCCTCTTAAGTTCTACGATGACCAACACCGTCCCCTGCACTTCCAGAACTTCGCCGAGCTCGAG
GACATCTGGGTTGACCGGGCTGACAACTTTGCGTAA
Gene >Pro_DTO377G3_2|g5056.t1
ATGGCCTCATTGCCTCCCCCTCCTCCACCTCCGGGATGGAGTGCAGCTCCTCCTATGCCGATGGCGCCGCCGCCC
CCGGGCTACCAACCACCAGCCGACCCGAATGTCGCAAAATTTGCGCAGAAGAAAAATGAATGGCTGCGCACGCAA
CGCAATCGGTTCGGCGAGAAGCGCAAAGCAGGATTTGTCGAAACACAAAAGGCTGATATGCCACCGGAGCATCTG
CGAAAGATTGTACGAGATATTGGCGATGTTTCTCAGAAGAAATTCACAAACGAGAAGCGGAGTTACCTCGGTGCG
CTCAAGTTCATGCCACATGCCGTCCTCAAGCTGTTGGAAAATATGCCCATGCCTTGGGAGTCAGCAAGAGAAGTT
AAGGTGCTTTATCACGTCAACGGATGCCTGACTCTAGTAAATGAGACGCCGCGTGTCATCGAGCCCGTTTTCCAC
GCCCAATGGGCAACGATGTGGATGTGCATGCGTCGGGAGAAGAGTGACCGGAGACACTTCAAGCGGATGCGTTTC
CCCCCATTTGACGACGAGGAACCACCTCTTTCGTGGTCCGAAAATATTGAAGATGTTGAACCGTTGGAGCCCATT
CAGATGGAACTGGATGAGGTCGAAGATGCGGCAGTTTATGAATGGTTCTACGACCACCGTCCCCTGCTTGATACC
CCCCACGTGAATGGACCGAGTTACAAGAAGTGGAATTTGTCTCTTCCCCAGATGGCGACTCTCCATCGGCTCAGT
CATCAGATTCTGAGTGATGTTGTTGACCAGAACTACTACCACATGTTCGACTTGAACAGCTTCTTCACAGCTAAG
GCCCTCAACGTGGCCATTCCTGGTGGACCCCGCTTCGAACCTTTGTATAAGGATATCGATCCTAATGACGAAGAT
TTCAGCGAGTTCAACGCCATTGACCGTATCATCTTCCGTGCCCCGATTCGAACCGAGTACCGGGTCACCTTCCCC
TTTCTCTACAACACCCTGCCTCGAAGCGTCAAGGTCGCTTGGTACTCCCATCCCCAAGTGGTCTACGTTCGCACC
GAGGATCCAAACCTGCCGGCTTTCTATTTCGATCCCGTCATCAACCCGATCTCCTCCCGCTCGGTCGCACCTAAA
AATATCACCGTCAGCCACGAAGACGAAATATTTGGGCCTGGCAATAATGAAGACGACGAATTTGAGCTTCCGGGT
GACGTTGAGCCCTTCTTTAACGACGAAGAACTCTACACATCCGAAACCGCGTCCGCCATCGCCCTGTGGTGGGCC
CCTCACCCATTCGATAAGAGATCTGGCAAGATGGTTCGTGCACAGGATGTGCCGTTGGTCAAGCAATGGTACTTG
GAGCACTGTCCACAGGGTCAGCCAGTCAAAGTCCGAGTCTCGTACCAGAAGATGCTGAAGACCTACGTTCTCAAC
GAATTGCACAAGGGCACCCCCAAGGCCCAGAGTAAGCAGAATCTCATGAAGACTCTCAAAACGACTAAGTTCTTC
CAGCAAACATCGATCGATTGGGTTGAGGCCGGTTTGCAAGTTTGTCGCCAGGGTTTCAACATGCTGAACCTGCTG
ATTCACCGCAAGAATTTGACATATCTCCACCTTGATTACAACTTCAATCTAAAGCCTGTCAAGACATTGACAACT
AAGGAGCGTAAGAAGTCTCGCTTCGGAAATGCTTTCCACTTGATGCGTGAAATTCTCCGGTTGACTAAGCTCATC
GTCGATGCCCAAGTCCAATATCGTCTGGGTAACATAGACGCCTTCCAGCTCGCAGATGGTATTCTTTATGCCTTC
AACCACGTGGGCCAGCTTACCGGTATGTATCGGTACAAGTATAAGCTTATGCACCAGATTCGTTCCTGCAAGGAT
CTGAAGCATTTGATTTACTACCGATTCAACTCCGGCCCCGTTGGTAAGGGCCCTGGATGTGGTTTCTGGGCGCCC
GCTTGGCGAGTCTGGCTTTTCTTCATGCGTGGCATCATTCCCCTGCTTGAGCGCTGGCTTGGAAATCTGCTTTCC
CGTCAGTTTGAGGGTCGTCACAGCAAGGGTGTTGCCAAGACAGTTACCAAGCAGCGTGTGGAATCTCATTTCGAT
CTCGAGTTGCGTGCCTCGGTCATGGCCGATCTTATGGACATGATGCCTGAGGGTATTAAGCAAAACAAGGTCAAC
GTGGTTTTGCAACATCTATCAGAGGCCTGGAGATGTTGGAAGAGTAACATTCCTTGGAAGGTTCCCGGCTTGCCC
GCACCAATTGAGAACATCATTCTTCGTTACGTCAAAAGCAAGGCCGACTGGTGGATCTCTGTCGCTCATTACAAC
CGAGAGAGAATTCGCCGCGGTGCCACAGTTGACAAGACTGTAGCAAAGAAGAACCTTGGTCGACTCACGCGTCTC
TGGCTCAAGTCTGAGCAAGAACGTCAGCACAACTATTTGAAGGACGGCCCTTACGTTTCCTCTGAAGAGGCGGTT
GCAATCTACACTACCATGGTTCATTGGTTGGAGTCTCGCAAGTTCTCCCCAATTCCCTTCCCCAGTGTTTCCTAT
AAGCACGACACCAAAATTCTGATTCTTGCACTCGAGCGGCTGCGCGAGTCGTACTCTGTTAAAGGAAGACTGAAT
CAAACCCAGCGAGAGGAATTGGCTCTTATCGAACAGGCCTATGATTCCCCTGGCACAACCTTGGCGAGAATTAAG
CGATTCCTTCTGACACAGAGAGCGTTCAAGGAGGTCAAGATTGACATGAACGATAACTACAACAACATCAATCCT
GTCTACGATATTGAGCCCATCGAAAAGATCACCGACGCTTATCTGGATCAATACCTTTGGTACCAAGCGGAGCAG
CGCCATCTCTTCCCCGCTTGGATCAAACCTTCCGACTCTGAGGTTCCCCCTTTACTCACATATAAGTGGACACAA
GGCATCAACAATTTGTCCAATGTCTGGGAGACTGCCGAAGGCGAGACGAACGTGATGATCGAGACTGAGCTGTCT
AAGGTCTATGAGAAGATCGATATCACTCTGCTGAACCGGCTGCTCCGTTTGATCATGGATCACAATCTGGCTGAC
TACATTACCTCAAAGAACAATGTTCAACTCAGCTACAAGGATATGAATCACACCAATAGCTATGGACTGATTCGC
GGTCTACAATTCTCGGGCTTCGTGTTCCAGTACTACGGCTTGATGATCGACCTGTTGCTCCTTGGCTTGCAGCGA
GCCAGTGAAATGGCCGGCCCTCCCGGAAGTCCCAACGATTTCTTGCAATTTAGAGATCGTGCCACTGAGACAAGG
CACCCCATCCGCCTGTATACCCGTTACGTTGATAAGATCTGGGTATTCTTCCGATTCCAGGCTGACGACTCCCGT
GACCTGATCCAGCGGTTCTTGACCGAGAATCCTGATCCTAACTTTGAGAACGTCATCGGCTACAAGAATAAAAAG
TGCTGGCCTCGCGATTGTCGCATGCGCTTGATGCGTCACGATGTCAACCTTGGTCGTGCTGTTTTCTGGGACATG
AAGAACCGCCTCCCAAGATCCATCACCACCATTGACTGGGATGATACATTCGCTAGCGTGTACAGTAAAGACAAC
CCTAACTTGCTGTTCTCGATGAATGGATTCGAAGTCCGTATTCTCCCCAAGATGCGGAATATGAACGAGGAGTTC
TCAGTCAAGGACAGTGTCTGGTCCCTGGTTGATAACTCTACCAAGGAACGGACGGCACATGCCTTCCTCCAGGTC
ACCGAAGAGGATGTCCAAAAGTTCAATAACCGTATCCGACAAATTCTGATGTCCTCTGGTTCGACCACATTCACC
AAGATTGCCAACAAGTGGAACACTGCTCTAATTGCTCTTTTCACTTACTATCGCGAGGCTGCTGTCTCGACTGTC
AACCTTCTCGATACTATCGTGAAGTGTGAAACGAAGATTCAGACTCGAGTCAAGATTGGTCTGAACTCTAAGATG
CCGTCTCGTTTCCCCCCGGCGGTCTTCTACACCCCTAAGGAGCTTGGAGGTCTTGGTATGATCTCAGGATCCCAT
ATCCTCATCCCAACCAGTGATAAGCGCTGGTCTAAGCAGACTGACACTGGTATTACTCACTTCCGAGCGGGTATG
TCTCATGACGAGGAAACATTGATTCCGAATATCTTCCGATACATCATTCCCTGGGAGGCCGAGTTTATTGACTCT
CAGCGTGTTTGGATGGAATACTCGCAGAAGCGTATGGAAGCCCAGCAGCAGAACCGCCGTCTCACGTTGGAAGAT
TTAGAGGACAGCTGGGATCGTGGTCTTCCCCGTATTAACACGCTCTTCCAGAAGGATCGAAGCACTCTCAGCTTC
GACAAGGGATTCCGACTCCGCGCTGAGTTCAAGCAATACCAGCTGATGAAGAGCAATCCGTTCTGGTGGACTAGC
CAGCGACACGACGGTAAGCTCTGGAACCTCAATGCCTACCGCACTGATGTTATCCAAGCATTGGGTGGTGTCGAA
ACAATTCTCGAGCACACCTTGTTCAAGGCGACAGCTTTCCCATCCTGGGAAGGTCTGTTCTGGGAAAAAGCGTGT
CTTGCCAAGGGAACTCGTCTCTTGCGATACGACGGGACCGAGATCAATGTCGAGGACGTGCGCGAAGGTGACCAA
CTTCTGGGCCCCGACAGAGAGCCTCGCCGTGCATTCAACATAGTGAATGGCATCGACCGCCTGTACCGCGTCAAA
ATCGGCGGTGAGAAAGAAGATCTCGTGGTGACGCCGAATCATATTCTAGTGCTCCATCGGGAGGGAGCCTCCAAT
GGTCCCAAAAAGCAAACCGTGGAGATCACTGCTGCCGAGTTCGCTGCCCTTCCTACTGAGGAAAGAAATATGTAC
AGTGCCTTTACATCTCCTAGGGTTGAGCAGAGCGCCGAATCTTCATCTCCTCAAATTCACAGTTTCAAGATCGAG
CACATTAGCCTCGAATCTGAGAAGACAGAGTGGGCTGGTTTCCGAGTCGACAAAGATCAGCTTTACCTGCGCCAT
GACTACCTTGTTCTGCACAACAGTGGTTTCGAAGAAAGTATGAAATTCAAGAAGCTCACCAACGCTCAGCGGTCC
GGTTTGAACCAGATTCCCAACCGTCGATTCACTCTCTGGTGGTCGCCGACTATCAACCGCGCCAACGTCTACGTC
GGTTTCCAGGTGCAACTTGATTTGACTGGTATCTTCTTACACGGCAAAATTCCCACCCTGAAAATTTCGTTGATT
CAGATTTTCCGTGCCCATCTGTGGCAGAAGATTCACGAATCGGTGGTCATGGATTTGTGTCAAGTCCTGGATCAG
GAATTGGAACAGCTTGGCATCGAGGCCGTTCAAAAAGAGACTATTCACCCACGTAAATCTTACAAGATGAACAGC
TCTTGTGCGGATATCTTGCTCTTCGCGACCAACAAGTGGAATGTCACCCGACCTTCGCTTGTGTTCGATACCAAG
GACGTCTACGAGCCGACCACGACAAACAAGTTCTGGATCGACGTGCAGCTCAGATATGGTGACTACGATTCTCAC
GACATTGAACGTTACGTCCGTGCTAAGTACCTCGATTACACCACGGACAGCATGAGTATCTATCCTTCCGCCACT
GGATTAATGATTGGTGTTGATCTTGCATACAACCTCTTCTCGGCTTACGGGCAGTACTTCCCAGGCCTGAAGACT
CTGGTTCAGCAAGCTATGGCTAAAATCATGAAAGCTAACCCAGCTTTGTATGTCTTGCGTGAGCGTATCCGCAAG
GGTCTCCAGCTGTATGCCTCGGAGAGCAGTCAGGAGTTCCTCAATTCTCAGAACTACTCCGAGCTCTTCAGTCCG
CAGATTCAGCTCTTTATCGACGACACTAACGTCTATCGCGTCACGATCCATAAGACATTTGAGGGTAACTTGACG
ACAAAGCCCATTAACGGTGCAATCTTCATTTTCAACCCTCGAACTGGACAATTGTTCCTGAAGATTATCCACACC
AGTGTCTGGGCAGGCCAAAAGCGTCTGGGTCAATTGGCCAAGTGGAAGACAGCCGAAGAAGTTGCAGCTCTCATT
CGGTCTCTCCCCGTTGAAGAGCAACCGAAGCAGCTCATTGTCACCCGCAAGGGTCTTCTTGACCCTCTCGAGGTC
CATCTGCTCGATTTCCCCAACATCTCTATTCGTGCCTCTGAGCTCCAGCTGCCCTTCCAGGCCGCCATGAAGGTT
GAGAAACTAGCCGATATGATTCTCCGTGCCACTGAACCTCAGATGGTACTCTTCAACTTGTATGATGAGTGGCTC
AAGTCTATCTCCCCGTACACTGCCTTTTCTCGACTCATTCTCATTCTTCGGGCTCTTCACGTCAATATCGACAAA
GCCAAGATCATTCTTCGGCCCGATAAGACCGTTATCACTCAAGAACATCACATCTGGCCATCCCTGTCTGATGAG
GACTGGATCAAGGTCGAAGTGCAATTGCGTGATCTGATCTTGAATGACTATGGCAAGAAGAACAATGTCAACGTG
CAGAGCTTGACCAGTAGCGAAGTTCGTGATATTATCCTGGGTATGGAGATTAGTGCGCCTTCTCTGCAGCGACAG
CAGGCAGCGGAGATCGAGAAGCAGCAAGAAGAGCAGAAGCAGCTCACTGCTGTGACTACCAAGACCCAGAACGCT
CGTGGTGAGGACATTATCGTCACCACTACATCTCAGTACGAACAGCAATCATTTGCATCTAAGACAGAGTGGCGT
ACTCGTGCAATTGCGACCTCCAATCTCCGGACGAGGTCCAACAACATCTATGTCTCCTCTGATGACATCCGGGAC
GATGGCTACACCTACATCATGCCCAAGAACGTCCTCAAGCGATTCATCACCATCGCTGATCTCCGAGTGCAGGTC
ACGGGCTACATCTACGGTAGCTCCCCCCCAGACAATGACCAGGTCAAGGAGGTCCGCACCATTGTCATGATTCCA
CAAGTGGGTAACACCCGAGACGTCCAGCTGCCACACCAGTTGCCGCAGCACGACTATCTCCAAAATCTAGAGCCG
CTCGGTATTATCCATACGGTTTCTGGCAATGAGCCGCCGTACATGTCTGCGGCAGATGTCACACATCACGCACGT
CTCATGAACGCCCATCCTTCGTGGGATAAGAGGACCGTGACCATGACTGTTTCTTTTACTCCTGGATCCGTTTCA
CTTGCCGCCTGGGGTCTCACTCCGGCGGGCTACAAGTGGGGCGCAGAGAACAAGGACACAACCTCGGATCAGCCA
CAAGGCTTCTCCACCAACATGGGTGAGAAGTGTCAGCTGCTTCTCAGTGACAAGATCCGCGGCTATTTCCTTGTG
CCCGAGGATAACGTCTGGAACTATAGCTTTATGGGCAGCTCTTTTGGTAGCGTGGAGAAGAGACCTATCTACGTC
AAGATTGATACCCCTCTTAAGTTCTACGATGACCAACACCGTCCCCTGCACTTCCAGAACTTCGCCGAGCTCGAG
GACATCTGGGTTGACCGGGCTGACAACTTTGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail