Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5054.t1
Gene name
Locationscaffold_11:432293..433541
Strand-
Gene length (bp)1248
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01215 COX5B Cytochrome c oxidase subunit Vb 1.2E-56 43 168

GO

GO Term Description Terminal node
GO:0004129 cytochrome-c oxidase activity Yes
GO:0005740 mitochondrial envelope Yes
GO:0015075 ion transmembrane transporter activity No
GO:0044464 cell part No
GO:0005215 transporter activity No
GO:0015002 heme-copper terminal oxidase activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0031967 organelle envelope No
GO:0044429 mitochondrial part No
GO:0044444 cytoplasmic part No
GO:0044446 intracellular organelle part No
GO:0016676 oxidoreductase activity, acting on a heme group of donors, oxygen as acceptor No
GO:0008324 cation transmembrane transporter activity No
GO:0003824 catalytic activity No
GO:0044424 intracellular part No
GO:0031975 envelope No
GO:0016675 oxidoreductase activity, acting on a heme group of donors No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0016491 oxidoreductase activity No
GO:0015078 proton transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0044422 organelle part No
GO:0009055 electron transfer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5054.t1
MFLQRTASALARRSPARAFTLAQRPFSSSVIRSSDKKWAPKQEGKILTFDEIKTEDDLFAPGAKPGTIPTDLEQA
TGLERLELIGKMQGIDIFDMRPLDASRKGTIEDPIIVNSAGDEQYAGCTGYPVDSHQVNWLTVSRDRPIERCREC
GNVVKMNYVGPEEDPHSHDDHGHHHHPAHVEPKTFADYVKPDYWYR*
Coding >Pro_DTO377G3_2|g5054.t1
ATGTTCCTCCAACGTACAGCCTCCGCCCTCGCCAGGCGCTCGCCTGCCCGCGCTTTTACCCTCGCCCAGCGGCCC
TTCTCTTCCTCTGTCATTCGCTCCAGCGACAAGAAGTGGGCTCCCAAGCAGGAGGGCAAGATCTTGACCTTCGAT
GAGATCAAGACCGAGGATGACCTCTTTGCCCCGGGTGCCAAGCCCGGTACCATTCCCACCGATCTCGAGCAGGCC
ACCGGTCTTGAGCGTCTGGAACTCATCGGAAAGATGCAGGGAATTGACATCTTCGACATGCGTCCCCTTGATGCC
TCCCGCAAGGGTACAATCGAAGACCCCATCATCGTCAACAGCGCCGGTGATGAGCAGTACGCCGGTTGCACCGGT
TACCCTGTAGACTCCCACCAGGTCAACTGGCTGACTGTCTCTCGCGATCGTCCCATCGAGCGCTGCCGCGAGTGC
GGTAACGTGGTCAAGATGAACTACGTCGGACCCGAGGAGGACCCCCACTCCCACGACGACCACGGTCACCACCAC
CACCCCGCTCACGTCGAGCCCAAGACCTTCGCCGACTACGTCAAGCCTGACTACTGGTACCGGTAA
Transcript >Pro_DTO377G3_2|g5054.t1
ATGTTCCTCCAACGTACAGCCTCCGCCCTCGCCAGGCGCTCGCCTGCCCGCGCTTTTACCCTCGCCCAGCGGCCC
TTCTCTTCCTCTGTCATTCGCTCCAGCGACAAGAAGTGGGCTCCCAAGCAGGAGGGCAAGATCTTGACCTTCGAT
GAGATCAAGACCGAGGATGACCTCTTTGCCCCGGGTGCCAAGCCCGGTACCATTCCCACCGATCTCGAGCAGGCC
ACCGGTCTTGAGCGTCTGGAACTCATCGGAAAGATGCAGGGAATTGACATCTTCGACATGCGTCCCCTTGATGCC
TCCCGCAAGGGTACAATCGAAGACCCCATCATCGTCAACAGCGCCGGTGATGAGCAGTACGCCGGTTGCACCGGT
TACCCTGTAGACTCCCACCAGGTCAACTGGCTGACTGTCTCTCGCGATCGTCCCATCGAGCGCTGCCGCGAGTGC
GGTAACGTGGTCAAGATGAACTACGTCGGACCCGAGGAGGACCCCCACTCCCACGACGACCACGGTCACCACCAC
CACCCCGCTCACGTCGAGCCCAAGACCTTCGCCGACTACGTCAAGCCTGACTACTGGTACCGGTAA
Gene >Pro_DTO377G3_2|g5054.t1
ATGTTCCTCCAACGTACAGCCTCCGCCCTCGCCAGGCGCTCGCCTGCCCGCGCTTTTACCCTCGCCCAGCGGCCC
TTCTCTTCCTCTGTCATTCGCTGTACGTGACTCCTCAGATGGCCTGATCCGACTTTCGCACAACTGCTCCAATCC
CGCGCACCCCGACCACAAGGGGCGATGCTCAGTCAATTGGTCTGAATCTTCTATTATGACCACCAGCTAACGTGA
AACTTTAATAGCCAGCGACAAGAAGTGGGCTCCCAAGCAGGAGGGCAAGATCTTGACCTTCGATGGTTAGTGCTT
TACCCGACCCCATGCCAGTCAATTACTTTTCTTCCGGCCTGTGCGGCTCGACAAGGATCCATATAGTCACGCACT
CGAGAATATGCGTGCAATTGGACGCTATACAACTTCGGGTGCTGGTCATGCGGATACTTTTCCCGAGCCACGGGC
CAGGCTTGTCATTCTACCTCGAGTGGATAACTACAAAAAATCTCCAAAAACCACAATGCTGACCTATCTTCTCGA
TATATAGAGATCAAGACCGAGGATGACCTCTTTGCCCCGGGTGCCAAGCCCGGTACCATTCCCACCGATCTCGAG
CAGGCCACCGGTCTTGAGCGTCTGGAACTCATCGGAAAGATGCAGGGAATTGACATCTTCGACATGCGTCCCCTT
GATGCCTCCCGCAAGGGTATGACTCCTTAATATCTCAAGTTTCCATCGCAATTCCCGAATGAATGATCAAATACC
GGGGGAATTGCGTGATCATTACTTCGGGGCGAAGACCGAGACATTGGCTAACAAAATGCGTCGATTTATTCAGGT
ACAATCGAAGACCCCATCATCGTCAACAGCGCCGGTGATGAGCAGTACGCCGGTTGCACCGGTTACCCTGTAGAC
TCCCACCAGGTCAACTGGCTGACTGTATGACCGCCCTATCCAAGCCCAACCGGGCTAATATTTCCAGCTCTAGAG
ACTGACTATGCGTCTTTTAGGTCTCTCGCGATCGTCCCATCGAGCGCTGCCGCGAGTGCGGTAACGTGGTCAAGA
TGAACTACGTCGGACCCGAGGAGGACCCCCACTCCCGTATGTTTCCTGCTCTCTTTTTTGCTTATAGTATATGAT
AATCTGTTGGTTGTGCTAACATTATCACCCTCAGACGACGACCACGGTCACCACCACCACCCCGCTCACGTCGAG
CCCAAGACCTTCGCCGACTACGTCAAGCCTGACTACTGGTACCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail