Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5053.t1
Gene name
Locationscaffold_11:429463..431860
Strand+
Gene length (bp)2397
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 6.2E-19 149 514

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 155 177 22
2 192 214 22
3 235 257 22
4 267 289 22
5 296 313 17
6 333 355 22
7 367 389 22
8 423 445 22
9 456 478 22
10 488 510 22
11 531 553 22
12 568 587 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5053.t1
MACGGGKSQSGLSHFFPRGNQIFLHFAPPGNRVLVISIDYLLLPAAHFVLDLNILCFQSASSLGSMASGNEITTL
AVHSNKEDLTKFAPESPGVVNNDEALYPETTTNRRNPVGSRLGSIIRAFENQLVEYNLEARGIERVAVDERMKRN
TWMSYLQIFLLWISINLAPNNITLGMLGPAVYGLNFLDSALCAVFGSLVGSIVSSWMATWGPVSGIRTLAFGRYS
MGWWPSKIIVLLNLIQMIGYGLIDCVVGGQILSAVSPGGMSVAVGIVIIAVISWAVATFGIQVFHYYERFAFLPQ
VIVVCILFGVSSVKFDLSTTSIGDSRTVAGNRLSFFSICLSAAITYAPLAADFFVYYPENTSRLKIFSLCLAGLL
VSFTMALVCGVGLASGIPTFPEYSAAYEKGQGALIVEGFGPLHGFGKFCSVICALGLIANTVAPTYSAGIDFQIL
GRYAEAVPRVIWNTIAVIIYTVCALVGRSNLSEIFTNFLALMGYWVVIWIAIVLEERFIFRLRTGYNWGIWRDPS
KLPIGIAAFTAFIVGWVGAVLCMAQLWYIGPIAKLVGEYGADMGIYVGFCWTALVYPPLRFIELRFVGR*
Coding >Pro_DTO377G3_2|g5053.t1
ATGGCTTGTGGTGGCGGAAAAAGCCAAAGCGGGCTATCTCATTTCTTTCCCCGCGGCAATCAAATCTTTCTCCAT
TTTGCCCCCCCTGGAAATCGGGTGCTTGTCATATCAATTGATTACCTGCTATTACCTGCTGCTCACTTTGTTTTG
GATTTGAATATCCTCTGCTTTCAAAGTGCCTCTTCTCTCGGAAGCATGGCTTCAGGAAATGAAATCACCACCTTA
GCGGTGCACTCCAACAAGGAAGACCTGACGAAATTCGCGCCTGAAAGTCCCGGCGTGGTCAACAACGATGAGGCA
CTTTACCCCGAGACGACGACCAATCGCCGCAATCCCGTTGGATCACGATTGGGCTCCATTATTAGAGCTTTTGAG
AACCAGCTCGTCGAGTATAATTTAGAAGCGCGTGGTATCGAACGAGTTGCCGTGGATGAGCGCATGAAGCGCAAC
ACGTGGATGTCGTATCTGCAAATCTTCTTGCTTTGGATCTCCATTAACCTTGCACCCAATAACATCACCCTCGGG
ATGTTAGGGCCTGCAGTCTATGGTCTCAACTTCCTAGACTCGGCACTTTGTGCTGTCTTTGGCTCTCTAGTTGGT
TCCATCGTCTCGTCTTGGATGGCCACATGGGGGCCCGTTTCCGGGATCCGAACATTGGCATTCGGAAGGTATTCG
ATGGGCTGGTGGCCTAGCAAGATCATTGTTCTATTGAACCTTATTCAGATGATTGGATACGGCTTGATTGATTGC
GTCGTTGGCGGACAAATATTGTCTGCTGTCTCCCCTGGTGGCATGTCCGTGGCTGTCGGCATCGTGATCATTGCG
GTTATCAGCTGGGCTGTTGCCACATTCGGCATCCAAGTTTTTCACTACTATGAACGATTCGCATTTTTGCCCCAA
GTAATTGTGGTTTGCATCCTTTTCGGGGTGTCATCCGTGAAGTTTGACTTGTCAACCACCTCTATTGGCGATTCC
CGGACAGTAGCTGGCAATAGGCTATCCTTCTTCTCCATCTGTCTGAGTGCCGCAATCACCTATGCCCCACTAGCA
GCCGACTTCTTCGTCTACTACCCCGAAAACACCTCTCGGCTGAAGATATTCAGTCTATGCCTGGCAGGCCTTCTT
GTCTCCTTCACGATGGCCCTAGTCTGCGGCGTCGGGTTAGCCTCAGGCATACCCACGTTCCCAGAGTATTCCGCC
GCCTATGAGAAAGGCCAAGGAGCACTAATCGTCGAAGGATTCGGCCCGCTGCACGGCTTCGGCAAATTCTGCTCG
GTTATCTGCGCCCTAGGCCTGATCGCTAATACCGTCGCGCCCACTTACTCCGCCGGCATCGACTTCCAGATCCTC
GGTCGCTACGCCGAGGCCGTACCGCGCGTCATCTGGAATACCATTGCCGTCATTATCTATACTGTCTGCGCGCTC
GTTGGCCGCAGCAACCTCTCTGAGATCTTCACCAATTTCCTCGCTTTGATGGGCTACTGGGTTGTCATTTGGATT
GCTATTGTCCTCGAGGAACGGTTCATCTTCCGCCTCCGTACTGGGTACAACTGGGGCATCTGGCGGGATCCGTCA
AAGCTACCCATTGGCATTGCGGCTTTCACTGCCTTTATCGTTGGCTGGGTGGGCGCCGTATTGTGTATGGCGCAG
CTGTGGTACATTGGACCCATTGCCAAATTGGTCGGCGAATACGGTGCTGATATGGGAATTTACGTCGGGTTCTGT
TGGACTGCGCTTGTTTACCCTCCTCTCAGATTCATCGAACTTCGTTTCGTGGGTCGCTGA
Transcript >Pro_DTO377G3_2|g5053.t1
ATGGCTTGTGGTGGCGGAAAAAGCCAAAGCGGGCTATCTCATTTCTTTCCCCGCGGCAATCAAATCTTTCTCCAT
TTTGCCCCCCCTGGAAATCGGGTGCTTGTCATATCAATTGATTACCTGCTATTACCTGCTGCTCACTTTGTTTTG
GATTTGAATATCCTCTGCTTTCAAAGTGCCTCTTCTCTCGGAAGCATGGCTTCAGGAAATGAAATCACCACCTTA
GCGGTGCACTCCAACAAGGAAGACCTGACGAAATTCGCGCCTGAAAGTCCCGGCGTGGTCAACAACGATGAGGCA
CTTTACCCCGAGACGACGACCAATCGCCGCAATCCCGTTGGATCACGATTGGGCTCCATTATTAGAGCTTTTGAG
AACCAGCTCGTCGAGTATAATTTAGAAGCGCGTGGTATCGAACGAGTTGCCGTGGATGAGCGCATGAAGCGCAAC
ACGTGGATGTCGTATCTGCAAATCTTCTTGCTTTGGATCTCCATTAACCTTGCACCCAATAACATCACCCTCGGG
ATGTTAGGGCCTGCAGTCTATGGTCTCAACTTCCTAGACTCGGCACTTTGTGCTGTCTTTGGCTCTCTAGTTGGT
TCCATCGTCTCGTCTTGGATGGCCACATGGGGGCCCGTTTCCGGGATCCGAACATTGGCATTCGGAAGGTATTCG
ATGGGCTGGTGGCCTAGCAAGATCATTGTTCTATTGAACCTTATTCAGATGATTGGATACGGCTTGATTGATTGC
GTCGTTGGCGGACAAATATTGTCTGCTGTCTCCCCTGGTGGCATGTCCGTGGCTGTCGGCATCGTGATCATTGCG
GTTATCAGCTGGGCTGTTGCCACATTCGGCATCCAAGTTTTTCACTACTATGAACGATTCGCATTTTTGCCCCAA
GTAATTGTGGTTTGCATCCTTTTCGGGGTGTCATCCGTGAAGTTTGACTTGTCAACCACCTCTATTGGCGATTCC
CGGACAGTAGCTGGCAATAGGCTATCCTTCTTCTCCATCTGTCTGAGTGCCGCAATCACCTATGCCCCACTAGCA
GCCGACTTCTTCGTCTACTACCCCGAAAACACCTCTCGGCTGAAGATATTCAGTCTATGCCTGGCAGGCCTTCTT
GTCTCCTTCACGATGGCCCTAGTCTGCGGCGTCGGGTTAGCCTCAGGCATACCCACGTTCCCAGAGTATTCCGCC
GCCTATGAGAAAGGCCAAGGAGCACTAATCGTCGAAGGATTCGGCCCGCTGCACGGCTTCGGCAAATTCTGCTCG
GTTATCTGCGCCCTAGGCCTGATCGCTAATACCGTCGCGCCCACTTACTCCGCCGGCATCGACTTCCAGATCCTC
GGTCGCTACGCCGAGGCCGTACCGCGCGTCATCTGGAATACCATTGCCGTCATTATCTATACTGTCTGCGCGCTC
GTTGGCCGCAGCAACCTCTCTGAGATCTTCACCAATTTCCTCGCTTTGATGGGCTACTGGGTTGTCATTTGGATT
GCTATTGTCCTCGAGGAACGGTTCATCTTCCGCCTCCGTACTGGGTACAACTGGGGCATCTGGCGGGATCCGTCA
AAGCTACCCATTGGCATTGCGGCTTTCACTGCCTTTATCGTTGGCTGGGTGGGCGCCGTATTGTGTATGGCGCAG
CTGTGGTACATTGGACCCATTGCCAAATTGGTCGGCGAATACGGTGCTGATATGGGAATTTACGTCGGGTTCTGT
TGGACTGCGCTTGTTTACCCTCCTCTCAGATTCATCGAACTTCGTTTCGTGGGTCGCTGA
Gene >Pro_DTO377G3_2|g5053.t1
ATGGCTTGTGTGTTGTAACTAGTACAATAACTATGGATGTAGTATGTCAGGTAAGGTGGTGGCGGAAAAAGCCAA
AGCGGGCTATCTCATTTCTTTCCCCGCGGCAATCAAATCTTTCTCCATTTTGCCCCCCCTGGAAATCGGGTGCTT
GTCATATCAATTGATTACCTGCTATTACCTGCTGCTCACTTTGTTTTGGATTTGAATATCCTCTGCTTTCAAAGG
TGAAATATGCCTGTGTGATTGCCTGATCAAGTCCGCTGACGTTGGTCATAGTGCCTCTTCTCTCGGAAGGTAACA
CAACCTGTGCCACAAAGGACGGCTATCATGAAGACGAGTAGTGTGGCAATCTCTCACGATCAAGGTATCTAGGAC
AAGCATCCTGCATGAAGACCGGTGTTCGACTATCGTCGTTCTGAGAATATACGGTTAAACTTGATCTGGGTAATT
CCAGCGAAAGGACTCAATGCGCTTTTCCTCTCTTCAGGAAATAGGTGTGATACTAACAGAATCGCAGCATGGCTT
CAGGAAATGAAATCACCACCTTAGCGGTGCACTCCAACAAGGAAGACCTGACGAAATTCGCGCCTGAAAGTCCCG
GCGTGGTCAACAACGATGAGGCACTTTACCCCGAGACGACGACCAATCGCCGCAATCCCGTTGGATCACGATTGG
GCTCCATTATTAGAGCTTTTGAGAACCAGCTCGTCGAGTATAATTTAGAAGCGCGTGGTATCGAACGAGTTGCCG
TGGATGAGCGCATGAAGCGCAACACGTGGATGTCGTATCTGCAAATCTTCTTGCTTTGGATCTCCATTAACCTTG
CACCCAATAACATCACCCTCGGGATGTTAGGGCCTGCAGTCTATGGTCTCAACTTCCTAGACTCGGCACTTTGTG
CTGTCTTTGGCTCTCTAGTTGGTTCCATCGTCTCGTCTTGGATGGCCACATGGGGGCCCGTTTCCGGGATCCGAA
CATTGGTGCGTAGCACATATTGAATCCGTTGGACTATTATTTGATCGAGAGGGCTAATCGGTGACTAGGCATTCG
GAAGGTATTCGATGGGCTGGTGGCCTAGCAAGATCATTGTTCTATTGAACCTTATTCAGATGATTGGATACGGCT
TGATTGATTGCGTCGTTGGCGGACAAATATTGTCTGCTGTCTCCCCTGGTGGCATGTCCGTGGCTGTCGGTGGGT
ATTCCGAAAACTTCATACATCAATAGTGATACTAATCTTGATATTATAGGCATCGTGATCATTGCGGTTATCAGC
TGGGCTGTTGCCACATTCGGCATCCAAGTTTTTCACTACTATGAACGGTTAGTCTTGAGAGATTATTGCCATGAG
GAACAATGTCACTGACGGGCCTCATTAGATTCGCATTTTTGCCCCAAGTAATTGTGGTTTGCATCCTTTTCGGGG
TGTCATCCGTGAAGTTTGACTTGTCAACCACCTCTATTGGCGATTCCCGGACAGTAGCTGGCAATAGGTGAGTCT
GCTTCTTACAACTAAGAATCGAAGCCCGGTTTTCTAACATGGTCCTAGGCTATCCTTCTTCTCCATCTGTCTGAG
TGCCGCAATCACCTATGCCCCACTAGCAGCCGACTTCTTCGTCTACTACCCCGAAAACACCTCTCGGCTGAAGAT
ATTCAGTCTATGCCTGGCAGGCCTTCTTGTCTCCTTCACGATGGCCCTAGTCTGCGGCGTCGGGTTAGCCTCAGG
CATACCCACGTTCCCAGAGTATTCCGCCGCCTATGAGAAAGGCCAAGGAGCACTAATCGTCGAAGGATTCGGCCC
GCTGCACGGCTTCGGCAAATTCTGCTCGGTTATCTGCGCCCTAGGCCTGATCGCTAATACCGTCGCGCCCACTTA
CTCCGCCGGCATCGACTTCCAGATCCTCGGTCGCTACGCCGAGGCCGTACCGCGCGTCATCTGGAATACCATTGC
CGTCATTATCTATACTGTCTGCGCGCTCGTTGGCCGCAGCAACCTCTCTGAGATCTTCACCAATTTCCTCGCTTT
GATGGGCTACTGGGTTGTCATTTGGATTGCTATTGTCCTCGAGGAACGGTTCATCTTCCGCCTCCGTACTGGGTA
CAACTGGGGCATCTGGCGGGATCCGTCAAAGCTACCCATTGGCATTGCGGCTTTCACTGCCTTTATCGTTGGCTG
GGTGGGCGCCGTATTGTGTATGGCGCAGCTGTGGTACATTGGACCCATTGCCAAATTGGTCGGCGAATACGGTGC
TGATGTGAGTTAAATCCCATCTCCCATCATGTGTGTATTTGTTCCTAACTAATTACTCTCTAGATGGGAATTTAC
GTCGGGTTCTGTTGGACTGCGCTTGTTTACCCTCCTCTCAGATTCATCGAACTTCGTTTCGTGGGTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail