Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5052.t1
Gene name
Locationscaffold_11:428096..429078
Strand+
Gene length (bp)982
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 5.8E-09 101 141
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 8.7E-06 102 141

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 142.01 83.24 200.79
5d_25C Five days - 25 degrees Celsius 231.87 140.93 322.82
7d_25C Seven days - 25 degrees Celsius 227.53 137.82 317.24
10d_25C Ten days - 25 degrees Celsius 302.61 183.97 421.25
7d_15C Seven days - 15 degrees Celsius 160.35 94.92 225.79
7d_30C Seven days - 30 degrees Celsius 327.77 201.14 454.39

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.016361 yes
3d_25C 7d_25C 0.024892 yes
3d_25C 7d_15C 0.677784 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.956619 no
5d_25C 7d_15C 0.095876 no
5d_25C 7d_30C 0.107568 no
5d_25C 10d_25C 0.255376 no
7d_25C 7d_15C 0.119953 no
7d_25C 7d_30C 0.087906 no
7d_25C 10d_25C 0.215991 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.787478 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5052.t1
MSSPPTSKRLKTSTTSAPPHMLSQQQIHPFHRVPTFEGIPIPTASLSQQNPGASRKRPPSPTGSSAMMTGQGNPS
GGVIDDSGAIPTVESTPKKKGRTNTPWTAEEEQRLKTMRDAGRSWSEIAKTFPTRTEGSVKKHWYKDMHYAEFAE
DESVKLREAIKEYEANKWKVIGQKVGKPAKACEQYAKEHFKNV*
Coding >Pro_DTO377G3_2|g5052.t1
ATGTCTTCCCCCCCGACATCTAAACGCCTCAAGACGTCAACAACCAGCGCCCCCCCGCATATGCTTTCGCAACAA
CAGATCCATCCATTCCACCGCGTCCCAACCTTTGAAGGCATCCCGATTCCGACTGCTTCTCTATCCCAACAAAAC
CCCGGCGCTTCGCGCAAACGTCCTCCTTCTCCCACGGGATCGTCAGCCATGATGACAGGCCAAGGGAACCCTTCG
GGTGGTGTGATTGATGACTCCGGTGCCATTCCCACGGTTGAGTCTACGCCTAAGAAGAAGGGACGCACCAATACC
CCATGGACCGCAGAGGAGGAGCAAAGGCTGAAGACAATGCGCGACGCCGGGCGCAGTTGGAGTGAAATTGCCAAG
ACTTTCCCGACCCGAACCGAGGGCAGTGTCAAGAAGCATTGGTATAAGGACATGCACTACGCGGAATTTGCCGAA
GATGAGTCTGTGAAGCTTCGGGAGGCGATCAAGGAGTACGAGGCGAACAAGTGGAAGGTGATCGGCCAGAAAGTG
GGCAAGCCTGCCAAAGCTTGCGAACAGTATGCCAAAGAGCATTTCAAGAACGTCTGA
Transcript >Pro_DTO377G3_2|g5052.t1
ATGTCTTCCCCCCCGACATCTAAACGCCTCAAGACGTCAACAACCAGCGCCCCCCCGCATATGCTTTCGCAACAA
CAGATCCATCCATTCCACCGCGTCCCAACCTTTGAAGGCATCCCGATTCCGACTGCTTCTCTATCCCAACAAAAC
CCCGGCGCTTCGCGCAAACGTCCTCCTTCTCCCACGGGATCGTCAGCCATGATGACAGGCCAAGGGAACCCTTCG
GGTGGTGTGATTGATGACTCCGGTGCCATTCCCACGGTTGAGTCTACGCCTAAGAAGAAGGGACGCACCAATACC
CCATGGACCGCAGAGGAGGAGCAAAGGCTGAAGACAATGCGCGACGCCGGGCGCAGTTGGAGTGAAATTGCCAAG
ACTTTCCCGACCCGAACCGAGGGCAGTGTCAAGAAGCATTGGTATAAGGACATGCACTACGCGGAATTTGCCGAA
GATGAGTCTGTGAAGCTTCGGGAGGCGATCAAGGAGTACGAGGCGAACAAGTGGAAGGTGATCGGCCAGAAAGTG
GGCAAGCCTGCCAAAGCTTGCGAACAGTATGCCAAAGAGCATTTCAAGAACGTCTGA
Gene >Pro_DTO377G3_2|g5052.t1
ATGTCGTAAGTCCCTTCGTCTGTGATCTCCGTCCGGCCTCCAGCTGTAGGAGGGAGACTGGGTTGGAACTCAAGT
GCACTTGGTCGCGTTCTTATTATATTGCCTTACCTCATCTTATGTTTCTACTATTCATTAACTTGTTGCCCGATT
AGTTCCCCCCCGACATCTAAACGCCTCAAGACGTCAACAACCAGCGCCCCCCCGCATATGCTTTCGCAACAACAG
ATCCATCCATTCCACCGCGTCCCAACCTTTGAAGGCATCCCGATTCCGACTGCTTCTCTATCCCAACAAAACCCC
GGCGCTTCGCGCAAACGTCCTCCTTCTCCCACGGGATCGTCAGCCATGATGACAGGCCAAGGGAACCCTTCGGGT
GGTGTGATTGATGACTCCGGTGCCATTCCCACGGTTGAGTCTACGCCTAAGAAGAAGGGACGCACCAATACCCCA
TGGACCGCAGAGGAGGAGCAAAGGCTGAAGACAATGCGCGACGCCGGGCGCAGTTGGAGTGAAATTGCCAAGGTG
CGCGCGCGGCTTTTTATAGGCTGAAACTATGGGTTGCTGACCTGGGCCTTTTTTTTCTTACCCGTCGCAGACTTT
CCCGACCCGAACCGAGGGCAGTGTCAAGAAGCATTGGTATAAGGTACGCAATATTAAGCGATTTGGGTAATACCA
CGTCTCGTCTTACTGACACCTTGCGCAGGACATGCACTACGCGGAATTTGCCGAAGATGAGGTATGATCCCGAGT
CCTTTTAATGTCCGTTGTCGCATCCGTTCCTGACGTCGCACAGTCTGTGAAGCTTCGGGAGGCGATCAAGGAGTA
CGAGGCGAACAAGTGGAAGGTGATCGGCCAGAAAGTGGGCAAGCCTGCCAAAGTAAGCACCGGAATCTCCTGCAT
GTCATTGTGCATCGCATCTAATCTCGATATTCTCCGACAGGCTTGCGAACAGTATGCCAAAGAGCATTTCAAGAA
CGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail