Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5041.t1
Gene name
Locationscaffold_11:396887..398258
Strand-
Gene length (bp)1371
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.9E-06 45 112
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.7E-08 55 149
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.8E-09 89 184
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.4E-11 126 217
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.9E-12 156 249
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.1E-10 225 296
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.3E-09 304 388
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.3E-07 370 432
PF13637 Ank_4 Ankyrin repeats (many copies) 9.7E-07 53 105
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-06 153 208
PF13637 Ank_4 Ankyrin repeats (many copies) 8.4E-06 229 261
PF13637 Ank_4 Ankyrin repeats (many copies) 8.7E-10 361 412
PF00023 Ank Ankyrin repeat 4.8E-03 88 113
PF00023 Ank Ankyrin repeat 8.7E-03 190 217
PF00023 Ank Ankyrin repeat 4.6E-05 252 280
PF00023 Ank Ankyrin repeat 1.5E-05 392 422
PF13606 Ank_3 Ankyrin repeat 7.3E-04 189 215
PF13606 Ank_3 Ankyrin repeat 5.2E-06 252 278
PF13606 Ank_3 Ankyrin repeat 1.0E-03 391 417
PF13857 Ank_5 Ankyrin repeats (many copies) 4.1E-07 174 228
PF13857 Ank_5 Ankyrin repeats (many copies) 5.4E-08 378 430

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5041.t1
MSLLSLPNEILLAIAENQDCEKDINAFARTSGRCYILLNPFLYAYNVREHQGSALHWAATQGIVRAAQESLQQGA
EIESRDWETQNPPLILAAYYGHADMVTFLLAQGADPYAESGGRTQDAITSAVLRNKTAVAEILLDSGIDANRTDY
RGSSLLHLAAESSPLSLKAVVRILIERGANLESRNELSQTPLQVACKSGSVEVARCLIESGANLNVRSESGSSLL
HLAFSEVKTVELLVQKGADIEAKDEQGETPLHLACRDGWVETASFLLDHGADIESRSLDGSTPLMRGVLWESIIC
RELGPTSVTTLLLSRGANPRQGNDFDITPLHCATAKANSALFRLLLRYGADVEPKTRAGVTPLHKLASTGSLDSA
RQLLQRGADAQPRDEEGNTPLHMAAERNDVEFISLLLAAGADRLVRNNKGQFPIHVVSKAAHKSEERQREVMALL
EVWSDN*
Coding >Pro_DTO377G3_2|g5041.t1
ATGTCTCTCCTCAGTTTGCCAAACGAAATTTTGCTAGCCATAGCAGAGAACCAAGACTGCGAAAAAGACATAAAT
GCGTTTGCAAGAACCAGTGGCCGTTGCTATATCCTCCTGAACCCCTTCCTCTATGCCTACAACGTCCGAGAGCAC
CAGGGAAGCGCCCTCCATTGGGCAGCAACCCAAGGAATTGTGAGGGCGGCCCAAGAATCACTCCAGCAAGGAGCA
GAAATTGAATCGAGGGACTGGGAAACACAAAACCCGCCGTTGATACTGGCCGCTTACTACGGCCATGCTGATATG
GTTACCTTCCTGTTGGCACAGGGCGCTGACCCGTACGCCGAAAGCGGCGGGAGGACCCAAGACGCGATCACATCA
GCTGTGCTCCGCAATAAAACAGCCGTCGCTGAAATCTTGCTTGATAGCGGGATTGATGCAAATAGGACGGACTAC
AGGGGAAGCAGCCTATTGCATCTTGCGGCTGAATCATCTCCCCTCAGCCTCAAGGCAGTGGTGAGAATTCTTATT
GAGAGAGGTGCCAATCTGGAATCTAGGAATGAACTGAGTCAGACTCCGTTACAGGTAGCGTGTAAGTCTGGTTCC
GTGGAAGTGGCCCGATGTCTCATAGAGAGCGGTGCCAATTTGAATGTGCGGAGTGAAAGTGGAAGTTCGCTCCTG
CACCTGGCGTTCAGTGAAGTCAAGACCGTTGAGTTGTTGGTGCAGAAAGGAGCTGATATCGAGGCGAAAGATGAG
CAAGGTGAGACACCACTGCATCTGGCATGTCGGGATGGCTGGGTCGAAACAGCATCATTCTTGCTGGACCATGGT
GCAGATATAGAGTCAAGATCGCTAGATGGGAGCACACCATTGATGCGGGGAGTACTCTGGGAGAGTATTATATGC
AGGGAGCTGGGCCCAACCTCTGTGACCACCCTCTTGCTGTCACGAGGTGCCAATCCAAGGCAGGGAAATGATTTC
GATATCACACCATTGCATTGTGCGACGGCCAAAGCAAATTCTGCGCTTTTCAGGCTATTGCTACGATATGGTGCC
GATGTAGAGCCAAAAACTAGGGCTGGCGTGACGCCGCTACACAAATTAGCGTCCACTGGCTCACTGGACTCCGCA
AGGCAATTGTTGCAGAGAGGCGCTGATGCACAACCGAGGGACGAAGAAGGCAATACACCATTGCACATGGCAGCG
GAGAGAAATGATGTGGAATTCATCAGTTTGCTGCTAGCGGCAGGCGCTGACCGGCTGGTCAGAAACAACAAGGGT
CAATTTCCTATACATGTAGTATCAAAAGCAGCACACAAATCAGAAGAAAGACAGAGAGAAGTGATGGCTCTCCTC
GAGGTTTGGTCTGATAATTAG
Transcript >Pro_DTO377G3_2|g5041.t1
ATGTCTCTCCTCAGTTTGCCAAACGAAATTTTGCTAGCCATAGCAGAGAACCAAGACTGCGAAAAAGACATAAAT
GCGTTTGCAAGAACCAGTGGCCGTTGCTATATCCTCCTGAACCCCTTCCTCTATGCCTACAACGTCCGAGAGCAC
CAGGGAAGCGCCCTCCATTGGGCAGCAACCCAAGGAATTGTGAGGGCGGCCCAAGAATCACTCCAGCAAGGAGCA
GAAATTGAATCGAGGGACTGGGAAACACAAAACCCGCCGTTGATACTGGCCGCTTACTACGGCCATGCTGATATG
GTTACCTTCCTGTTGGCACAGGGCGCTGACCCGTACGCCGAAAGCGGCGGGAGGACCCAAGACGCGATCACATCA
GCTGTGCTCCGCAATAAAACAGCCGTCGCTGAAATCTTGCTTGATAGCGGGATTGATGCAAATAGGACGGACTAC
AGGGGAAGCAGCCTATTGCATCTTGCGGCTGAATCATCTCCCCTCAGCCTCAAGGCAGTGGTGAGAATTCTTATT
GAGAGAGGTGCCAATCTGGAATCTAGGAATGAACTGAGTCAGACTCCGTTACAGGTAGCGTGTAAGTCTGGTTCC
GTGGAAGTGGCCCGATGTCTCATAGAGAGCGGTGCCAATTTGAATGTGCGGAGTGAAAGTGGAAGTTCGCTCCTG
CACCTGGCGTTCAGTGAAGTCAAGACCGTTGAGTTGTTGGTGCAGAAAGGAGCTGATATCGAGGCGAAAGATGAG
CAAGGTGAGACACCACTGCATCTGGCATGTCGGGATGGCTGGGTCGAAACAGCATCATTCTTGCTGGACCATGGT
GCAGATATAGAGTCAAGATCGCTAGATGGGAGCACACCATTGATGCGGGGAGTACTCTGGGAGAGTATTATATGC
AGGGAGCTGGGCCCAACCTCTGTGACCACCCTCTTGCTGTCACGAGGTGCCAATCCAAGGCAGGGAAATGATTTC
GATATCACACCATTGCATTGTGCGACGGCCAAAGCAAATTCTGCGCTTTTCAGGCTATTGCTACGATATGGTGCC
GATGTAGAGCCAAAAACTAGGGCTGGCGTGACGCCGCTACACAAATTAGCGTCCACTGGCTCACTGGACTCCGCA
AGGCAATTGTTGCAGAGAGGCGCTGATGCACAACCGAGGGACGAAGAAGGCAATACACCATTGCACATGGCAGCG
GAGAGAAATGATGTGGAATTCATCAGTTTGCTGCTAGCGGCAGGCGCTGACCGGCTGGTCAGAAACAACAAGGGT
CAATTTCCTATACATGTAGTATCAAAAGCAGCACACAAATCAGAAGAAAGACAGAGAGAAGTGATGGCTCTCCTC
GAGGTTTGGTCTGATAATTAG
Gene >Pro_DTO377G3_2|g5041.t1
ATGTCTCTCCTCAGTTTGCCAAACGAAATTTTGCTAGCCATAGCAGAGAACCAAGACTGCGAAAAAGACATAAAT
GCGTTTGCAAGAACCAGTGGCCGTTGCTATATCCTCCTGAACCCCTTCCTCTATGCCTACAACGTCCGAGAGCAC
CAGGGAAGCGCCCTCCATTGGGCAGCAACCCAAGGAATTGTGAGGGCGGCCCAAGAATCACTCCAGCAAGGAGCA
GAAATTGAATCGAGGGACTGGGAAACACAAAACCCGCCGTTGATACTGGCCGCTTACTACGGCCATGCTGATATG
GTTACCTTCCTGTTGGCACAGGGCGCTGACCCGTACGCCGAAAGCGGCGGGAGGACCCAAGACGCGATCACATCA
GCTGTGCTCCGCAATAAAACAGCCGTCGCTGAAATCTTGCTTGATAGCGGGATTGATGCAAATAGGACGGACTAC
AGGGGAAGCAGCCTATTGCATCTTGCGGCTGAATCATCTCCCCTCAGCCTCAAGGCAGTGGTGAGAATTCTTATT
GAGAGAGGTGCCAATCTGGAATCTAGGAATGAACTGAGTCAGACTCCGTTACAGGTAGCGTGTAAGTCTGGTTCC
GTGGAAGTGGCCCGATGTCTCATAGAGAGCGGTGCCAATTTGAATGTGCGGAGTGAAAGTGGAAGTTCGCTCCTG
CACCTGGCGTTCAGTGAAGTCAAGACCGTTGAGTTGTTGGTGCAGAAAGGAGCTGATATCGAGGCGAAAGATGAG
CAAGGTGAGACACCACTGCATCTGGCATGTCGGGATGGCTGGGTCGAAACAGCATCATTCTTGCTGGACCATGGT
GCAGATATAGAGTCAAGATCGCTAGATGGGAGCACACCATTGATGCGGGGAGTACTCTGGGAGAGTATTATATGC
AGGGAGCTGGGCCCAACCTCTGTGACCACCCTCTTGCTGTCACGAGGTGCCAATCCAAGGCAGGGAAATGATTTC
GATATCACACCATTGCATTGTGCGACGGCCAAAGCAAATTCTGCGCTTTTCAGGCTATTGCTACGATATGGTGCC
GATGTAGAGCCAAAAACTAGGGCTGGCGTGACGCCGCTACACAAATTAGCGTCCACTGGCTCACTGGACTCCGCA
AGGCAATTGTTGCAGAGAGGCGCTGATGCACAACCGAGGGACGAAGAAGGCAATACACCATTGCACATGGCAGCG
GAGAGAAATGATGTGGAATTCATCAGTTTGCTGCTAGCGGCAGGCGCTGACCGGCTGGTCAGAAACAACAAGGGT
CAATTTCCTATACATGTAGTATCAAAAGCAGCACACAAATCAGAAGAAAGACAGAGAGAAGTGATGGCTCTCCTC
GAGGTTTGGTCTGATAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail