Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5003.t1
Gene name
Locationscaffold_11:294517..296809
Strand-
Gene length (bp)2292
Transcript length (bp)2292
Coding sequence length (bp)2292
Protein length (aa) 764

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01902 Diphthami_syn_2 Diphthamide synthase 6.4E-12 113 282
PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP 3.3E-07 411 465

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 32.68 19.59 45.76
5d_25C Five days - 25 degrees Celsius 46.33 28.22 64.45
7d_25C Seven days - 25 degrees Celsius 58.94 35.88 81.99
10d_25C Ten days - 25 degrees Celsius 94.35 56.78 131.92
7d_15C Seven days - 15 degrees Celsius 51.58 31.05 72.10
7d_30C Seven days - 30 degrees Celsius 50.19 30.39 69.98

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.110807 no
3d_25C 7d_25C 0.001804 yes
3d_25C 7d_15C 0.027948 yes
3d_25C 7d_30C 0.038966 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.315901 no
5d_25C 7d_15C 0.710324 no
5d_25C 7d_30C 0.787764 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.628189 no
7d_25C 7d_30C 0.534889 no
7d_25C 10d_25C 0.024417 yes
7d_15C 7d_30C 0.936482 no
7d_15C 10d_25C 0.002297 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5003.t1
MSAAQPSAPGLNVIALISGGKDSLYSILHCIRNGHKVVALANLYPEPRNKTASASPNQRKNDEEEDIDSFMYQTI
GHSVIPLYETALQIPLYRQPITGGAVDTARIYGTRATTMDETESLVPLLRRIKQAHPEANAVSAGAILSTYQRTR
IESVANRLGLIPIAWLWMYPSLPAPTARTADALAIRQAGLLEDMSAARCDARIIKVASGGLDEGFLWENVSGVGS
GGRMMRRCLVKAMSRFAAAEDIRGAVLGEGGEYETLALDGPGFLWKQRIEVGSREEKVGDGGVAFVRLRGARCTA
KSAWEIGDGIAPSDIRRPGLLDAVFEGVLGSALELFGSLDDSKSRAMTSTARSPDWPVCEPVHRLSGSTWTISNI
VAPEAGPGAGQQMKAIAYKVEKVLKSFAHPKSGSRSTDDIVFATVLLNSMTDFGPMNDIYVSLFKKPNPPARVTV
ACGDRLPSNVKVMVTFVVDLGARERRQALHVQSRSYWAPANIGPYSQALSVPLQNDSRLVYIAGQIPLDPGSMDL
ARVEGSSSWIENYRLRAVLALQHLWRIGEAMQVNWWLGAVAFLARGDHANTQAQVAWRLWERMHALPDNEDEDDD
DGPQLDAWDIKYGRRTEELTDTPVPSLPQFTALVESHTSIPPFLAVQVDELPRGSDIEWQGLGGLCEQVKLDIKG
GTSSTTMDSQYKYTNIEIDAGSSDDTLKQILRSVKEAYCRDSSLSQAVLYTTYPVPEASWPVQVVPCRSVWGREG
RRLSAGVVLQQFS*
Coding >Pro_DTO377G3_2|g5003.t1
ATGTCTGCAGCACAGCCTTCAGCCCCAGGGCTTAACGTGATTGCCCTAATCTCCGGTGGCAAAGACTCTCTCTAC
TCGATCCTCCACTGCATCCGCAACGGCCACAAAGTGGTCGCCTTAGCCAACCTCTACCCAGAACCGCGGAACAAA
ACCGCAAGCGCAAGTCCAAACCAACGCAAAAATGACGAAGAAGAAGACATCGATAGCTTCATGTACCAAACCATC
GGCCACAGTGTAATCCCTCTCTACGAAACAGCCCTCCAAATCCCCCTCTACCGCCAACCCATCACAGGCGGCGCA
GTCGACACAGCCCGTATCTATGGAACCAGAGCCACCACCATGGACGAGACCGAGTCTCTCGTCCCGCTTCTTCGT
CGCATAAAACAGGCTCATCCAGAAGCCAACGCCGTATCTGCAGGCGCCATCCTTTCTACTTATCAGCGCACGCGA
ATCGAGAGCGTCGCTAACCGCCTGGGTCTGATTCCCATTGCTTGGCTGTGGATGTATCCATCTCTTCCAGCCCCT
ACGGCTAGAACGGCCGATGCCCTGGCAATACGCCAGGCGGGGCTGTTGGAGGATATGTCGGCCGCTAGGTGTGAT
GCTCGTATTATCAAGGTCGCCTCCGGTGGCCTGGACGAGGGCTTCCTGTGGGAGAATGTCTCTGGTGTTGGGAGT
GGCGGCCGCATGATGCGAAGGTGTCTTGTCAAGGCTATGAGTCGGTTTGCAGCTGCGGAAGATATCCGTGGCGCG
GTGCTGGGTGAGGGCGGAGAGTATGAGACGCTTGCGCTGGATGGGCCTGGTTTCTTGTGGAAGCAGAGGATCGAG
GTCGGTAGTCGGGAGGAGAAGGTTGGTGATGGGGGTGTTGCGTTTGTTAGGTTGAGGGGGGCTAGGTGTACGGCT
AAGAGCGCGTGGGAGATTGGCGATGGCATTGCGCCGAGTGATATTAGGCGGCCTGGATTGTTAGATGCGGTTTTT
GAGGGCGTGTTAGGATCTGCATTGGAACTTTTTGGCTCGCTTGACGATTCGAAATCGCGGGCGATGACGAGTACT
GCTCGGTCGCCAGATTGGCCTGTCTGCGAGCCCGTGCATCGGTTGTCTGGTTCTACGTGGACTATTTCGAATATT
GTTGCGCCCGAGGCTGGTCCCGGGGCAGGACAGCAGATGAAAGCGATTGCATACAAGGTCGAGAAAGTGCTCAAG
TCCTTTGCCCACCCCAAGTCCGGTTCCCGATCAACAGACGACATTGTTTTCGCTACGGTGCTGCTAAATTCAATG
ACCGACTTTGGACCAATGAATGACATCTACGTCTCGCTATTCAAGAAGCCCAATCCCCCCGCGCGAGTGACAGTG
GCATGTGGAGACCGTCTCCCGTCTAACGTCAAGGTGATGGTCACATTCGTGGTGGACCTGGGTGCAAGGGAACGG
CGCCAGGCCCTGCATGTTCAATCCAGGTCATACTGGGCGCCCGCAAATATTGGACCATATTCGCAAGCGTTGTCA
GTTCCGTTGCAGAACGATAGCAGACTTGTGTACATTGCTGGTCAGATTCCTCTAGATCCTGGTTCTATGGACCTG
GCGCGAGTCGAGGGGTCAAGTTCATGGATTGAAAATTACCGTCTTCGAGCTGTACTGGCCCTTCAGCATCTCTGG
AGAATTGGTGAAGCCATGCAGGTAAACTGGTGGCTCGGTGCGGTGGCCTTCTTGGCTCGTGGCGACCACGCTAAT
ACCCAGGCGCAAGTGGCATGGCGCCTCTGGGAAAGAATGCATGCTTTACCTGACAATGAGGACGAGGATGATGAC
GATGGGCCACAGCTGGACGCGTGGGATATCAAATATGGCCGTCGCACAGAGGAGCTGACCGATACCCCTGTGCCC
AGTCTGCCCCAGTTCACTGCTCTTGTTGAGTCTCACACATCCATTCCACCATTCCTGGCTGTTCAAGTGGATGAA
CTACCACGAGGAAGCGATATTGAATGGCAAGGTCTAGGGGGCCTGTGCGAGCAGGTCAAGCTGGACATTAAAGGG
GGGACATCTTCCACCACCATGGACAGTCAATACAAGTATACCAATATCGAGATCGACGCGGGTTCGTCGGACGAT
ACATTGAAGCAAATATTGAGATCAGTGAAAGAGGCTTACTGTCGAGATTCCAGTCTGTCTCAGGCTGTGTTATAT
ACCACATACCCAGTGCCTGAAGCTTCGTGGCCAGTGCAGGTTGTGCCGTGCAGATCAGTATGGGGGCGAGAAGGA
CGAAGGTTGAGTGCAGGTGTGGTCCTGCAGCAGTTTAGTTAG
Transcript >Pro_DTO377G3_2|g5003.t1
ATGTCTGCAGCACAGCCTTCAGCCCCAGGGCTTAACGTGATTGCCCTAATCTCCGGTGGCAAAGACTCTCTCTAC
TCGATCCTCCACTGCATCCGCAACGGCCACAAAGTGGTCGCCTTAGCCAACCTCTACCCAGAACCGCGGAACAAA
ACCGCAAGCGCAAGTCCAAACCAACGCAAAAATGACGAAGAAGAAGACATCGATAGCTTCATGTACCAAACCATC
GGCCACAGTGTAATCCCTCTCTACGAAACAGCCCTCCAAATCCCCCTCTACCGCCAACCCATCACAGGCGGCGCA
GTCGACACAGCCCGTATCTATGGAACCAGAGCCACCACCATGGACGAGACCGAGTCTCTCGTCCCGCTTCTTCGT
CGCATAAAACAGGCTCATCCAGAAGCCAACGCCGTATCTGCAGGCGCCATCCTTTCTACTTATCAGCGCACGCGA
ATCGAGAGCGTCGCTAACCGCCTGGGTCTGATTCCCATTGCTTGGCTGTGGATGTATCCATCTCTTCCAGCCCCT
ACGGCTAGAACGGCCGATGCCCTGGCAATACGCCAGGCGGGGCTGTTGGAGGATATGTCGGCCGCTAGGTGTGAT
GCTCGTATTATCAAGGTCGCCTCCGGTGGCCTGGACGAGGGCTTCCTGTGGGAGAATGTCTCTGGTGTTGGGAGT
GGCGGCCGCATGATGCGAAGGTGTCTTGTCAAGGCTATGAGTCGGTTTGCAGCTGCGGAAGATATCCGTGGCGCG
GTGCTGGGTGAGGGCGGAGAGTATGAGACGCTTGCGCTGGATGGGCCTGGTTTCTTGTGGAAGCAGAGGATCGAG
GTCGGTAGTCGGGAGGAGAAGGTTGGTGATGGGGGTGTTGCGTTTGTTAGGTTGAGGGGGGCTAGGTGTACGGCT
AAGAGCGCGTGGGAGATTGGCGATGGCATTGCGCCGAGTGATATTAGGCGGCCTGGATTGTTAGATGCGGTTTTT
GAGGGCGTGTTAGGATCTGCATTGGAACTTTTTGGCTCGCTTGACGATTCGAAATCGCGGGCGATGACGAGTACT
GCTCGGTCGCCAGATTGGCCTGTCTGCGAGCCCGTGCATCGGTTGTCTGGTTCTACGTGGACTATTTCGAATATT
GTTGCGCCCGAGGCTGGTCCCGGGGCAGGACAGCAGATGAAAGCGATTGCATACAAGGTCGAGAAAGTGCTCAAG
TCCTTTGCCCACCCCAAGTCCGGTTCCCGATCAACAGACGACATTGTTTTCGCTACGGTGCTGCTAAATTCAATG
ACCGACTTTGGACCAATGAATGACATCTACGTCTCGCTATTCAAGAAGCCCAATCCCCCCGCGCGAGTGACAGTG
GCATGTGGAGACCGTCTCCCGTCTAACGTCAAGGTGATGGTCACATTCGTGGTGGACCTGGGTGCAAGGGAACGG
CGCCAGGCCCTGCATGTTCAATCCAGGTCATACTGGGCGCCCGCAAATATTGGACCATATTCGCAAGCGTTGTCA
GTTCCGTTGCAGAACGATAGCAGACTTGTGTACATTGCTGGTCAGATTCCTCTAGATCCTGGTTCTATGGACCTG
GCGCGAGTCGAGGGGTCAAGTTCATGGATTGAAAATTACCGTCTTCGAGCTGTACTGGCCCTTCAGCATCTCTGG
AGAATTGGTGAAGCCATGCAGGTAAACTGGTGGCTCGGTGCGGTGGCCTTCTTGGCTCGTGGCGACCACGCTAAT
ACCCAGGCGCAAGTGGCATGGCGCCTCTGGGAAAGAATGCATGCTTTACCTGACAATGAGGACGAGGATGATGAC
GATGGGCCACAGCTGGACGCGTGGGATATCAAATATGGCCGTCGCACAGAGGAGCTGACCGATACCCCTGTGCCC
AGTCTGCCCCAGTTCACTGCTCTTGTTGAGTCTCACACATCCATTCCACCATTCCTGGCTGTTCAAGTGGATGAA
CTACCACGAGGAAGCGATATTGAATGGCAAGGTCTAGGGGGCCTGTGCGAGCAGGTCAAGCTGGACATTAAAGGG
GGGACATCTTCCACCACCATGGACAGTCAATACAAGTATACCAATATCGAGATCGACGCGGGTTCGTCGGACGAT
ACATTGAAGCAAATATTGAGATCAGTGAAAGAGGCTTACTGTCGAGATTCCAGTCTGTCTCAGGCTGTGTTATAT
ACCACATACCCAGTGCCTGAAGCTTCGTGGCCAGTGCAGGTTGTGCCGTGCAGATCAGTATGGGGGCGAGAAGGA
CGAAGGTTGAGTGCAGGTGTGGTCCTGCAGCAGTTTAGTTAG
Gene >Pro_DTO377G3_2|g5003.t1
ATGTCTGCAGCACAGCCTTCAGCCCCAGGGCTTAACGTGATTGCCCTAATCTCCGGTGGCAAAGACTCTCTCTAC
TCGATCCTCCACTGCATCCGCAACGGCCACAAAGTGGTCGCCTTAGCCAACCTCTACCCAGAACCGCGGAACAAA
ACCGCAAGCGCAAGTCCAAACCAACGCAAAAATGACGAAGAAGAAGACATCGATAGCTTCATGTACCAAACCATC
GGCCACAGTGTAATCCCTCTCTACGAAACAGCCCTCCAAATCCCCCTCTACCGCCAACCCATCACAGGCGGCGCA
GTCGACACAGCCCGTATCTATGGAACCAGAGCCACCACCATGGACGAGACCGAGTCTCTCGTCCCGCTTCTTCGT
CGCATAAAACAGGCTCATCCAGAAGCCAACGCCGTATCTGCAGGCGCCATCCTTTCTACTTATCAGCGCACGCGA
ATCGAGAGCGTCGCTAACCGCCTGGGTCTGATTCCCATTGCTTGGCTGTGGATGTATCCATCTCTTCCAGCCCCT
ACGGCTAGAACGGCCGATGCCCTGGCAATACGCCAGGCGGGGCTGTTGGAGGATATGTCGGCCGCTAGGTGTGAT
GCTCGTATTATCAAGGTCGCCTCCGGTGGCCTGGACGAGGGCTTCCTGTGGGAGAATGTCTCTGGTGTTGGGAGT
GGCGGCCGCATGATGCGAAGGTGTCTTGTCAAGGCTATGAGTCGGTTTGCAGCTGCGGAAGATATCCGTGGCGCG
GTGCTGGGTGAGGGCGGAGAGTATGAGACGCTTGCGCTGGATGGGCCTGGTTTCTTGTGGAAGCAGAGGATCGAG
GTCGGTAGTCGGGAGGAGAAGGTTGGTGATGGGGGTGTTGCGTTTGTTAGGTTGAGGGGGGCTAGGTGTACGGCT
AAGAGCGCGTGGGAGATTGGCGATGGCATTGCGCCGAGTGATATTAGGCGGCCTGGATTGTTAGATGCGGTTTTT
GAGGGCGTGTTAGGATCTGCATTGGAACTTTTTGGCTCGCTTGACGATTCGAAATCGCGGGCGATGACGAGTACT
GCTCGGTCGCCAGATTGGCCTGTCTGCGAGCCCGTGCATCGGTTGTCTGGTTCTACGTGGACTATTTCGAATATT
GTTGCGCCCGAGGCTGGTCCCGGGGCAGGACAGCAGATGAAAGCGATTGCATACAAGGTCGAGAAAGTGCTCAAG
TCCTTTGCCCACCCCAAGTCCGGTTCCCGATCAACAGACGACATTGTTTTCGCTACGGTGCTGCTAAATTCAATG
ACCGACTTTGGACCAATGAATGACATCTACGTCTCGCTATTCAAGAAGCCCAATCCCCCCGCGCGAGTGACAGTG
GCATGTGGAGACCGTCTCCCGTCTAACGTCAAGGTGATGGTCACATTCGTGGTGGACCTGGGTGCAAGGGAACGG
CGCCAGGCCCTGCATGTTCAATCCAGGTCATACTGGGCGCCCGCAAATATTGGACCATATTCGCAAGCGTTGTCA
GTTCCGTTGCAGAACGATAGCAGACTTGTGTACATTGCTGGTCAGATTCCTCTAGATCCTGGTTCTATGGACCTG
GCGCGAGTCGAGGGGTCAAGTTCATGGATTGAAAATTACCGTCTTCGAGCTGTACTGGCCCTTCAGCATCTCTGG
AGAATTGGTGAAGCCATGCAGGTAAACTGGTGGCTCGGTGCGGTGGCCTTCTTGGCTCGTGGCGACCACGCTAAT
ACCCAGGCGCAAGTGGCATGGCGCCTCTGGGAAAGAATGCATGCTTTACCTGACAATGAGGACGAGGATGATGAC
GATGGGCCACAGCTGGACGCGTGGGATATCAAATATGGCCGTCGCACAGAGGAGCTGACCGATACCCCTGTGCCC
AGTCTGCCCCAGTTCACTGCTCTTGTTGAGTCTCACACATCCATTCCACCATTCCTGGCTGTTCAAGTGGATGAA
CTACCACGAGGAAGCGATATTGAATGGCAAGGTCTAGGGGGCCTGTGCGAGCAGGTCAAGCTGGACATTAAAGGG
GGGACATCTTCCACCACCATGGACAGTCAATACAAGTATACCAATATCGAGATCGACGCGGGTTCGTCGGACGAT
ACATTGAAGCAAATATTGAGATCAGTGAAAGAGGCTTACTGTCGAGATTCCAGTCTGTCTCAGGCTGTGTTATAT
ACCACATACCCAGTGCCTGAAGCTTCGTGGCCAGTGCAGGTTGTGCCGTGCAGATCAGTATGGGGGCGAGAAGGA
CGAAGGTTGAGTGCAGGTGTGGTCCTGCAGCAGTTTAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail