Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g5002.t1
Gene name
Locationscaffold_11:291408..294174
Strand-
Gene length (bp)2766
Transcript length (bp)2709
Coding sequence length (bp)2709
Protein length (aa) 903

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 155 174 19
2 189 207 18
3 228 250 22
4 260 279 19
5 547 564 17
6 579 598 19
7 637 659 22
8 685 707 22
9 737 759 22
10 779 798 19
11 817 839 22
12 849 871 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g5002.t1
MSSPWKEEQEATFRTSTPLDPEAFAEDLRLFNRSPHPYHRSRRLGSCTPSDGDRLHPLSSYSRSSRTTSDSGTEA
DDESTGILRGLPAPPLRPRKGLRSGGVGLTEVDDWLPSLQPWPSFVRPILRTSRRSSEEELEEEAFEERLRFRRQ
RRVEVLRRLLEAALLLSVGGVVLYQDRARSLAWEWRKELAAHALVVLGLYASYPLAVRASQGRSWRIWRIWSTKR
TYFSIPASFDPAPLLYPILIPIFVSLSLSNHLPPLIMPNIILSLSSLPTPVIPFQNRANGFDNLHWMVSMIPILV
SEHFSSDHTVPKPLTLRGLDAESLILLFPLHQALIPTLDFLLTTSILPAELQLLTTALINLYLFAASPQMEILKA
LLWLGGMCLFASCRHILRWEVSLARIPSWKFRRAPHGAQSPRKFLNMMDHRICEKLSRTAHVPSDDATSDSDGPN
GFMFSRPRKTKTMQDNRSFRPSAEPTSAVDQVTTEAIFEKHARIVHRRRHTISTFDEVVREERVHTTPGGRRKKM
MGPGLASFLSLTSAQAQVRKWLYAFYVYVLSLIIILGPIRKYVAEHALQGQDPFGWAIGYLLGNFSKIRFWVLML
NLEYWIELPPRPDADNLSASCFLGSVEHIRQATFGAAVTRLLLSGYCALVLLTGLAIVVKLSSVAEVDTRRKIFH
GMMVVMFLPAIFVDPAFCAMALALVLSIFLLLDLFRASQLPPISRPLTYFLAPYVDGRDHRGPVIISHIFLLIGC
SIPLWLSLSDLPRTGLGPWAGWEVPSRDVSMASGVICVGMGDAAASLIGRRYGRLKWFWGGGKSLEGSIAFVVAV
TCGLIAVRAWLVLGGWPVSGLESAAVTAFSAHFWAWTLLKAVLAAAGTSATEAILTGCNDNVVVPVVLWLLVRGL
GV*
Coding >Pro_DTO377G3_2|g5002.t1
ATGAGTTCGCCGTGGAAAGAAGAACAAGAAGCGACGTTTCGCACCAGTACACCTCTGGACCCCGAAGCGTTCGCC
GAAGACCTCCGACTATTTAATCGCTCCCCCCATCCATACCACAGAAGTCGACGCCTCGGATCATGCACTCCCTCC
GACGGCGACCGTCTCCACCCGCTCTCCTCCTACTCCAGGTCCTCACGAACAACCAGCGACAGTGGCACAGAGGCA
GACGATGAAAGCACCGGTATTCTAAGGGGATTACCTGCCCCGCCCCTCCGTCCTCGAAAAGGCCTACGGTCTGGT
GGGGTGGGTCTCACTGAGGTCGATGACTGGCTGCCAAGTCTGCAACCGTGGCCGTCATTTGTGCGGCCTATTTTG
CGGACGTCGCGGCGGAGCTCGGAGGAAGAACTTGAGGAAGAGGCCTTTGAGGAGAGACTGAGGTTCAGGCGCCAG
AGACGGGTGGAGGTTCTCCGGCGGTTGTTGGAGGCTGCGCTTTTGTTGTCTGTGGGTGGCGTGGTCTTGTACCAA
GACCGGGCGCGCTCCTTAGCTTGGGAATGGAGAAAGGAGCTTGCTGCTCATGCCCTCGTGGTCTTGGGTCTCTAT
GCCAGCTATCCGCTCGCTGTTCGAGCATCGCAAGGCCGAAGCTGGCGCATCTGGCGCATCTGGTCCACGAAACGG
ACATACTTCTCAATACCCGCGAGCTTCGATCCGGCCCCCCTTCTCTATCCGATTCTTATCCCCATCTTCGTCTCG
TTATCGCTGTCCAACCATCTCCCGCCACTTATCATGCCTAATATCATCCTCAGCCTCTCCTCTTTACCAACGCCT
GTTATACCGTTCCAGAACCGGGCGAATGGATTTGATAACCTCCATTGGATGGTCTCTATGATTCCCATCCTCGTT
TCCGAACATTTCTCCTCGGACCATACTGTACCCAAACCATTGACGCTTCGCGGGCTCGACGCAGAGTCTTTAATA
CTTCTTTTCCCTTTGCATCAAGCGTTGATACCCACTTTAGACTTTTTGTTGACGACCAGCATTCTTCCCGCTGAG
CTGCAGCTTTTGACAACTGCTTTGATCAACTTGTACTTGTTTGCGGCCTCTCCCCAGATGGAGATACTCAAAGCC
TTGTTATGGCTTGGAGGCATGTGTTTGTTTGCTTCTTGTCGACATATACTGCGTTGGGAGGTTTCTTTGGCTAGA
ATTCCCAGCTGGAAATTCCGCCGCGCCCCACATGGCGCGCAATCTCCCCGCAAATTCTTGAACATGATGGACCAT
CGAATTTGTGAGAAGTTGAGTAGAACGGCGCACGTTCCATCGGACGATGCTACATCGGACAGCGATGGCCCTAAT
GGCTTCATGTTTTCAAGGCCGCGCAAGACGAAGACCATGCAGGATAATCGCTCTTTCCGCCCATCGGCAGAGCCG
ACATCTGCAGTCGACCAGGTCACGACGGAGGCGATTTTCGAGAAGCATGCTCGTATTGTGCATCGACGACGCCAT
ACCATATCTACATTCGACGAAGTCGTTCGAGAGGAACGTGTCCACACCACCCCCGGTGGTAGACGCAAGAAAATG
ATGGGTCCTGGCCTGGCCTCCTTCCTCTCGCTCACTTCAGCCCAGGCACAGGTCCGAAAATGGTTGTACGCATTT
TACGTGTATGTTCTGTCGCTGATTATCATTCTTGGGCCTATTCGAAAATACGTAGCAGAGCACGCACTACAAGGC
CAGGATCCGTTCGGTTGGGCTATCGGCTACCTGCTGGGAAACTTCTCGAAAATTCGCTTTTGGGTGCTTATGTTG
AACCTTGAATACTGGATCGAACTGCCACCCCGCCCTGATGCAGATAATCTGAGTGCCTCCTGCTTCCTTGGGTCG
GTCGAACATATTCGCCAGGCTACTTTTGGAGCTGCCGTGACCCGTCTACTACTCAGTGGATACTGCGCGTTGGTA
CTACTGACAGGCCTGGCTATTGTGGTTAAGCTCAGCTCTGTTGCCGAGGTTGATACGCGCCGCAAGATTTTCCAC
GGCATGATGGTGGTTATGTTCCTTCCCGCGATTTTTGTGGATCCAGCCTTCTGCGCCATGGCGCTAGCCTTGGTC
CTCTCCATATTCCTTCTACTTGACCTATTCCGCGCATCTCAACTACCTCCAATTTCGCGACCGCTTACCTACTTT
CTGGCCCCGTATGTTGACGGCCGTGATCACCGTGGCCCGGTCATCATCTCGCATATCTTCTTGCTAATTGGATGT
TCGATACCCCTTTGGCTGTCGCTTTCCGATCTCCCTCGGACTGGCCTGGGCCCCTGGGCCGGTTGGGAGGTACCG
TCACGGGATGTAAGCATGGCCAGCGGAGTTATCTGTGTTGGCATGGGCGACGCGGCTGCATCCCTCATTGGCCGA
CGGTACGGCCGGCTGAAATGGTTCTGGGGAGGCGGCAAATCACTTGAAGGCAGCATTGCTTTCGTTGTAGCTGTC
ACCTGCGGGCTGATCGCGGTTCGTGCCTGGTTGGTGCTCGGTGGCTGGCCCGTGTCTGGGCTCGAATCGGCTGCA
GTGACAGCTTTCTCCGCTCACTTCTGGGCCTGGACTTTGCTCAAGGCGGTTCTGGCGGCAGCCGGAACGAGCGCC
ACCGAAGCAATCCTTACCGGTTGTAATGACAATGTCGTGGTCCCAGTGGTGTTATGGCTGCTGGTGCGGGGTCTT
GGCGTCTGA
Transcript >Pro_DTO377G3_2|g5002.t1
ATGAGTTCGCCGTGGAAAGAAGAACAAGAAGCGACGTTTCGCACCAGTACACCTCTGGACCCCGAAGCGTTCGCC
GAAGACCTCCGACTATTTAATCGCTCCCCCCATCCATACCACAGAAGTCGACGCCTCGGATCATGCACTCCCTCC
GACGGCGACCGTCTCCACCCGCTCTCCTCCTACTCCAGGTCCTCACGAACAACCAGCGACAGTGGCACAGAGGCA
GACGATGAAAGCACCGGTATTCTAAGGGGATTACCTGCCCCGCCCCTCCGTCCTCGAAAAGGCCTACGGTCTGGT
GGGGTGGGTCTCACTGAGGTCGATGACTGGCTGCCAAGTCTGCAACCGTGGCCGTCATTTGTGCGGCCTATTTTG
CGGACGTCGCGGCGGAGCTCGGAGGAAGAACTTGAGGAAGAGGCCTTTGAGGAGAGACTGAGGTTCAGGCGCCAG
AGACGGGTGGAGGTTCTCCGGCGGTTGTTGGAGGCTGCGCTTTTGTTGTCTGTGGGTGGCGTGGTCTTGTACCAA
GACCGGGCGCGCTCCTTAGCTTGGGAATGGAGAAAGGAGCTTGCTGCTCATGCCCTCGTGGTCTTGGGTCTCTAT
GCCAGCTATCCGCTCGCTGTTCGAGCATCGCAAGGCCGAAGCTGGCGCATCTGGCGCATCTGGTCCACGAAACGG
ACATACTTCTCAATACCCGCGAGCTTCGATCCGGCCCCCCTTCTCTATCCGATTCTTATCCCCATCTTCGTCTCG
TTATCGCTGTCCAACCATCTCCCGCCACTTATCATGCCTAATATCATCCTCAGCCTCTCCTCTTTACCAACGCCT
GTTATACCGTTCCAGAACCGGGCGAATGGATTTGATAACCTCCATTGGATGGTCTCTATGATTCCCATCCTCGTT
TCCGAACATTTCTCCTCGGACCATACTGTACCCAAACCATTGACGCTTCGCGGGCTCGACGCAGAGTCTTTAATA
CTTCTTTTCCCTTTGCATCAAGCGTTGATACCCACTTTAGACTTTTTGTTGACGACCAGCATTCTTCCCGCTGAG
CTGCAGCTTTTGACAACTGCTTTGATCAACTTGTACTTGTTTGCGGCCTCTCCCCAGATGGAGATACTCAAAGCC
TTGTTATGGCTTGGAGGCATGTGTTTGTTTGCTTCTTGTCGACATATACTGCGTTGGGAGGTTTCTTTGGCTAGA
ATTCCCAGCTGGAAATTCCGCCGCGCCCCACATGGCGCGCAATCTCCCCGCAAATTCTTGAACATGATGGACCAT
CGAATTTGTGAGAAGTTGAGTAGAACGGCGCACGTTCCATCGGACGATGCTACATCGGACAGCGATGGCCCTAAT
GGCTTCATGTTTTCAAGGCCGCGCAAGACGAAGACCATGCAGGATAATCGCTCTTTCCGCCCATCGGCAGAGCCG
ACATCTGCAGTCGACCAGGTCACGACGGAGGCGATTTTCGAGAAGCATGCTCGTATTGTGCATCGACGACGCCAT
ACCATATCTACATTCGACGAAGTCGTTCGAGAGGAACGTGTCCACACCACCCCCGGTGGTAGACGCAAGAAAATG
ATGGGTCCTGGCCTGGCCTCCTTCCTCTCGCTCACTTCAGCCCAGGCACAGGTCCGAAAATGGTTGTACGCATTT
TACGTGTATGTTCTGTCGCTGATTATCATTCTTGGGCCTATTCGAAAATACGTAGCAGAGCACGCACTACAAGGC
CAGGATCCGTTCGGTTGGGCTATCGGCTACCTGCTGGGAAACTTCTCGAAAATTCGCTTTTGGGTGCTTATGTTG
AACCTTGAATACTGGATCGAACTGCCACCCCGCCCTGATGCAGATAATCTGAGTGCCTCCTGCTTCCTTGGGTCG
GTCGAACATATTCGCCAGGCTACTTTTGGAGCTGCCGTGACCCGTCTACTACTCAGTGGATACTGCGCGTTGGTA
CTACTGACAGGCCTGGCTATTGTGGTTAAGCTCAGCTCTGTTGCCGAGGTTGATACGCGCCGCAAGATTTTCCAC
GGCATGATGGTGGTTATGTTCCTTCCCGCGATTTTTGTGGATCCAGCCTTCTGCGCCATGGCGCTAGCCTTGGTC
CTCTCCATATTCCTTCTACTTGACCTATTCCGCGCATCTCAACTACCTCCAATTTCGCGACCGCTTACCTACTTT
CTGGCCCCGTATGTTGACGGCCGTGATCACCGTGGCCCGGTCATCATCTCGCATATCTTCTTGCTAATTGGATGT
TCGATACCCCTTTGGCTGTCGCTTTCCGATCTCCCTCGGACTGGCCTGGGCCCCTGGGCCGGTTGGGAGGTACCG
TCACGGGATGTAAGCATGGCCAGCGGAGTTATCTGTGTTGGCATGGGCGACGCGGCTGCATCCCTCATTGGCCGA
CGGTACGGCCGGCTGAAATGGTTCTGGGGAGGCGGCAAATCACTTGAAGGCAGCATTGCTTTCGTTGTAGCTGTC
ACCTGCGGGCTGATCGCGGTTCGTGCCTGGTTGGTGCTCGGTGGCTGGCCCGTGTCTGGGCTCGAATCGGCTGCA
GTGACAGCTTTCTCCGCTCACTTCTGGGCCTGGACTTTGCTCAAGGCGGTTCTGGCGGCAGCCGGAACGAGCGCC
ACCGAAGCAATCCTTACCGGTTGTAATGACAATGTCGTGGTCCCAGTGGTGTTATGGCTGCTGGTGCGGGGTCTT
GGCGTCTGA
Gene >Pro_DTO377G3_2|g5002.t1
ATGAGTTCGCCGTGGAAAGAAGAACAAGAAGCGACGTTTCGCACCAGTACACCTCTGGACCCCGAAGCGTTCGCC
GAAGACCTCCGACTATTTAATCGCTCCCCCCATCCATACCACAGAAGTCGACGCCTCGGATCATGCACTCCCTCC
GACGGCGACCGTCTCCACCCGCTCTCCTCCTACTCCAGGTCCTCACGAACAACCAGCGACAGTGGCACAGAGGCA
GACGATGAAAGCACCGGTATTCTAAGGGGATTACCTGCCCCGCCCCTCCGTCCTCGAAAAGGCCTACGGTCTGGT
GGGGTGGGTCTCACTGAGGTCGATGACTGGCTGCCAAGTCTGCAACCGTGGCCGTCATTTGTGCGGCCTATTTTG
CGGACGTCGCGGCGGAGCTCGGAGGAAGAACTTGAGGAAGAGGCCTTTGAGGAGAGACTGAGGTTCAGGCGCCAG
AGACGGGTGGAGGTTCTCCGGCGGTTGTTGGAGGCTGCGCTTTTGTTGTCTGTGGGTGGCGTGGTCTTGTACCAA
GACCGGGCGCGCTCCTTAGCTTGGGAATGGAGAAAGGGTATGGGGAAAACTGATATTGCTACCAAAAATCTGGGG
CGCGCTAATTGATATACAGAGCTTGCTGCTCATGCCCTCGTGGTCTTGGGTCTCTATGCCAGCTATCCGCTCGCT
GTTCGAGCATCGCAAGGCCGAAGCTGGCGCATCTGGCGCATCTGGTCCACGAAACGGACATACTTCTCAATACCC
GCGAGCTTCGATCCGGCCCCCCTTCTCTATCCGATTCTTATCCCCATCTTCGTCTCGTTATCGCTGTCCAACCAT
CTCCCGCCACTTATCATGCCTAATATCATCCTCAGCCTCTCCTCTTTACCAACGCCTGTTATACCGTTCCAGAAC
CGGGCGAATGGATTTGATAACCTCCATTGGATGGTCTCTATGATTCCCATCCTCGTTTCCGAACATTTCTCCTCG
GACCATACTGTACCCAAACCATTGACGCTTCGCGGGCTCGACGCAGAGTCTTTAATACTTCTTTTCCCTTTGCAT
CAAGCGTTGATACCCACTTTAGACTTTTTGTTGACGACCAGCATTCTTCCCGCTGAGCTGCAGCTTTTGACAACT
GCTTTGATCAACTTGTACTTGTTTGCGGCCTCTCCCCAGATGGAGATACTCAAAGCCTTGTTATGGCTTGGAGGC
ATGTGTTTGTTTGCTTCTTGTCGACATATACTGCGTTGGGAGGTTTCTTTGGCTAGAATTCCCAGCTGGAAATTC
CGCCGCGCCCCACATGGCGCGCAATCTCCCCGCAAATTCTTGAACATGATGGACCATCGAATTTGTGAGAAGTTG
AGTAGAACGGCGCACGTTCCATCGGACGATGCTACATCGGACAGCGATGGCCCTAATGGCTTCATGTTTTCAAGG
CCGCGCAAGACGAAGACCATGCAGGATAATCGCTCTTTCCGCCCATCGGCAGAGCCGACATCTGCAGTCGACCAG
GTCACGACGGAGGCGATTTTCGAGAAGCATGCTCGTATTGTGCATCGACGACGCCATACCATATCTACATTCGAC
GAAGTCGTTCGAGAGGAACGTGTCCACACCACCCCCGGTGGTAGACGCAAGAAAATGATGGGTCCTGGCCTGGCC
TCCTTCCTCTCGCTCACTTCAGCCCAGGCACAGGTCCGAAAATGGTTGTACGCATTTTACGTGTATGTTCTGTCG
CTGATTATCATTCTTGGGCCTATTCGAAAATACGTAGCAGAGCACGCACTACAAGGCCAGGATCCGTTCGGTTGG
GCTATCGGCTACCTGCTGGGAAACTTCTCGAAAATTCGCTTTTGGGTGCTTATGTTGAACCTTGAATACTGGATC
GAACTGCCACCCCGCCCTGATGCAGATAATCTGAGTGCCTCCTGCTTCCTTGGGTCGGTCGAACATATTCGCCAG
GCTACTTTTGGAGCTGCCGTGACCCGTCTACTACTCAGTGGATACTGCGCGTTGGTACTACTGACAGGCCTGGCT
ATTGTGGTTAAGCTCAGCTCTGTTGCCGAGGTTGATACGCGCCGCAAGATTTTCCACGGCATGATGGTGGTTATG
TTCCTTCCCGCGATTTTTGTGGATCCAGCCTTCTGCGCCATGGCGCTAGCCTTGGTCCTCTCCATATTCCTTCTA
CTTGACCTATTCCGCGCATCTCAACTACCTCCAATTTCGCGACCGCTTACCTACTTTCTGGCCCCGTATGTTGAC
GGCCGTGATCACCGTGGCCCGGTCATCATCTCGCATATCTTCTTGCTAATTGGATGTTCGATACCCCTTTGGCTG
TCGCTTTCCGATCTCCCTCGGACTGGCCTGGGCCCCTGGGCCGGTTGGGAGGTACCGTCACGGGATGTAAGCATG
GCCAGCGGAGTTATCTGTGTTGGCATGGGCGACGCGGCTGCATCCCTCATTGGCCGACGGTACGGCCGGCTGAAA
TGGTTCTGGGGAGGCGGCAAATCACTTGAAGGCAGCATTGCTTTCGTTGTAGCTGTCACCTGCGGGCTGATCGCG
GTTCGTGCCTGGTTGGTGCTCGGTGGCTGGCCCGTGTCTGGGCTCGAATCGGCTGCAGTGACAGCTTTCTCCGCT
CACTTCTGGGCCTGGACTTTGCTCAAGGCGGTTCTGGCGGCAGCCGGAACGAGCGCCACCGAAGCAATCCTTACC
GGTTGTAATGACAATGTCGTGGTCCCAGTGGTGTTATGGCTGCTGGTGCGGGGTCTTGGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail