Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4995.t1
Gene name
Locationscaffold_11:272710..273366
Strand-
Gene length (bp)656
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18126 Mitoc_mL59 Mitochondrial ribosomal protein mL59 7.6E-45 16 185

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 128.36 75.09 181.63
5d_25C Five days - 25 degrees Celsius 105.86 59.56 152.16
7d_25C Seven days - 25 degrees Celsius 101.97 57.30 146.64
10d_25C Ten days - 25 degrees Celsius 99.90 55.82 143.98
7d_15C Seven days - 15 degrees Celsius 96.83 53.59 140.07
7d_30C Seven days - 30 degrees Celsius 99.25 55.38 143.12

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.486839 no
3d_25C 7d_25C 0.386265 no
3d_25C 7d_15C 0.274948 no
3d_25C 7d_30C 0.321357 no
3d_25C 10d_25C 0.337211 no
5d_25C 7d_25C 0.919573 no
5d_25C 7d_15C 0.796287 no
5d_25C 7d_30C 0.853403 no
5d_25C 10d_25C 0.869837 no
7d_25C 7d_15C 0.888629 no
7d_25C 7d_30C 0.944174 no
7d_25C 10d_25C 0.958436 no
7d_15C 7d_30C 0.950624 no
7d_15C 10d_25C 0.934909 no
7d_30C 10d_25C 0.986740 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4995.t1
MSVSKQTGTLLENLPQRLVNFFARYPPQTHSAAVRRPAPANGEGYVPMKVESPYTPDRDAKGAPGEKKHGWTPSR
ALLVTSNDVRNPFLPHKRFGKWEAPKYGLRQQADLMKLAIKYNVGALLPPSRKSPEFKETRRAERGLQVKGTGVG
HKVKGHKWERTMESRLEDRRKAMEAMPEMVRMWKQRGHGRGWRQWPKR*
Coding >Pro_DTO377G3_2|g4995.t1
ATGTCGGTTTCGAAGCAGACGGGCACATTGTTGGAAAACCTTCCTCAACGCCTGGTAAATTTCTTCGCTCGGTAT
CCTCCACAAACCCACTCCGCAGCTGTCCGCCGTCCTGCCCCTGCGAACGGAGAGGGCTATGTACCAATGAAGGTA
GAATCCCCTTACACACCAGATCGCGATGCCAAGGGTGCACCAGGAGAGAAAAAGCATGGCTGGACTCCTTCACGA
GCACTCCTCGTGACCAGCAACGATGTCCGGAATCCATTTCTTCCACACAAGCGATTCGGCAAATGGGAAGCACCG
AAATATGGACTGCGCCAGCAAGCCGATCTGATGAAGCTGGCCATCAAGTACAATGTGGGGGCACTTCTTCCTCCT
AGTCGCAAATCACCTGAATTCAAGGAGACACGACGTGCAGAGCGTGGTTTGCAGGTCAAGGGAACTGGTGTTGGC
CATAAGGTCAAGGGTCACAAGTGGGAGCGCACCATGGAGTCACGTCTCGAGGACCGTCGCAAGGCGATGGAGGCA
ATGCCGGAGATGGTCAGGATGTGGAAGCAGAGAGGTCATGGCCGCGGCTGGAGACAATGGCCCAAGCGGTAA
Transcript >Pro_DTO377G3_2|g4995.t1
ATGTCGGTTTCGAAGCAGACGGGCACATTGTTGGAAAACCTTCCTCAACGCCTGGTAAATTTCTTCGCTCGGTAT
CCTCCACAAACCCACTCCGCAGCTGTCCGCCGTCCTGCCCCTGCGAACGGAGAGGGCTATGTACCAATGAAGGTA
GAATCCCCTTACACACCAGATCGCGATGCCAAGGGTGCACCAGGAGAGAAAAAGCATGGCTGGACTCCTTCACGA
GCACTCCTCGTGACCAGCAACGATGTCCGGAATCCATTTCTTCCACACAAGCGATTCGGCAAATGGGAAGCACCG
AAATATGGACTGCGCCAGCAAGCCGATCTGATGAAGCTGGCCATCAAGTACAATGTGGGGGCACTTCTTCCTCCT
AGTCGCAAATCACCTGAATTCAAGGAGACACGACGTGCAGAGCGTGGTTTGCAGGTCAAGGGAACTGGTGTTGGC
CATAAGGTCAAGGGTCACAAGTGGGAGCGCACCATGGAGTCACGTCTCGAGGACCGTCGCAAGGCGATGGAGGCA
ATGCCGGAGATGGTCAGGATGTGGAAGCAGAGAGGTCATGGCCGCGGCTGGAGACAATGGCCCAAGCGGTAA
Gene >Pro_DTO377G3_2|g4995.t1
ATGTCGGTTTCGAAGCAGACGGGCACATTGTTGGAAAACCTTCCTCAACGCCTGGTAAATTTCTTCGCTCGGTAT
CCTCCACAAACCCACTCCGCAGCTGTCCGCCGTCCTGCCCCTGCGAACGGAGAGGGCTATGTACCAATGAAGGTA
GAATCCCCTTACACACCAGATCGCGATGCCAAGGGTGCACCAGGAGAGAAAAAGCATGGCTGGACTCCTTCACGA
GCACTCCTCGTGACCAGCAACGATGTCCGGAATCCATTTCTTCCACACAAGCGATTCGGCAAATGGGAAGCACCG
AAATATGGACTGCGCCAGCAAGCCGATCTGATGAAGCTGGCCATCAAGTACAATGTGGGGGCACTTCTTCCTCCT
AGTCGCAAATCACCTGAATTCAAGGAGACACGACGTGCAGAGCGTGGTTTGCAGGTCAAGGGAACTGGTGTTGGC
CATAAGGTCAAGGGTCACAAGTGGGAGCGCACCATGGAGTCACGTCTCGAGGACCGTCGCAAGGCGATGGAGGCA
ATGCCGGAGATGGTCAGGATGTGGAAGCAGGTTAGTTCTCTATTGGTCCTTCCTGAAGTGGTTAGAGCAATGCTG
ACTCGGCGCAACAGAGAGGTCATGGCCGCGGCTGGAGACAATGGCCCAAGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail