Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4989.t1
Gene name
Locationscaffold_11:256468..258285
Strand-
Gene length (bp)1817
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00571 CBS CBS domain 2.2E-06 195 248
PF00571 CBS CBS domain 9.3E-03 273 317

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 104.52 64.04 145.00
5d_25C Five days - 25 degrees Celsius 135.24 82.29 188.20
7d_25C Seven days - 25 degrees Celsius 138.39 83.54 193.24
10d_25C Ten days - 25 degrees Celsius 148.43 89.60 207.27
7d_15C Seven days - 15 degrees Celsius 142.79 85.88 199.71
7d_30C Seven days - 30 degrees Celsius 114.79 70.05 159.53

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.257364 no
3d_25C 7d_25C 0.217400 no
3d_25C 7d_15C 0.155335 no
3d_25C 7d_30C 0.747272 no
3d_25C 10d_25C 0.113395 no
5d_25C 7d_25C 0.948143 no
5d_25C 7d_15C 0.867288 no
5d_25C 7d_30C 0.528301 no
5d_25C 10d_25C 0.754329 no
7d_25C 7d_15C 0.928840 no
7d_25C 7d_30C 0.461881 no
7d_25C 10d_25C 0.823284 no
7d_15C 7d_30C 0.373809 no
7d_15C 10d_25C 0.909884 no
7d_30C 10d_25C 0.285053 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4989.t1
MADHLHSREGSDASLNNASIASPRSSTESRSRNPLRISANHQHRQSLSESLRGPPGSPRARRQPSLPQSAIQSLI
DNPPPPKASNPAFVGRDWREISVGELVSPGDLKFVELDTGIEEATNILIDSGGAVLLIRETPESTSAVGTFDYAD
LNSYLLLAAGLTHPDEAHQASYDELAKKAHNGVPIPLRDVKKFGMEKEPLIKLPASANVLAAVEIFGGGVHRVVV
VNESNDQEVVGIFSQFRLVKFLWENRRSFPIIEELYPRALNELVIGSQEVISINGDKPLSDALHVMNNEGMSSIA
VVDNYLNVLGNISTADVKLLTRSSSLPLLHNTCTHFISIILSTRGLIEGKDSFPVFHVNPGSTLAHTVAKIVATR
SHRLWVTDPLSPTSSGPPTPSQSSVHLPLSNSISPATGGTANSESSEEAVTSYAQPSQYAAPHLPPPNPPFTYPA
VAVSVPSPISHSIPSSALDGARVSGRLAGVVSLTDILNLHARASGLNPADPADSRSRRRRSSSSSQSVRRSGDIG
RELFSRGGM*
Coding >Pro_DTO377G3_2|g4989.t1
ATGGCAGACCACTTACATTCTCGCGAAGGATCTGATGCTTCCCTCAACAATGCATCGATTGCTTCTCCGCGATCC
AGCACCGAATCTCGCTCTCGAAATCCACTTCGCATTTCAGCAAACCACCAGCATAGACAAAGCTTGAGCGAGTCG
CTTCGCGGCCCGCCAGGTTCCCCCCGTGCACGCCGGCAGCCATCACTCCCACAGTCGGCCATCCAGAGCCTTATC
GATAATCCACCGCCACCCAAGGCTAGCAACCCTGCCTTTGTTGGTCGTGATTGGAGAGAGATATCAGTTGGGGAG
CTGGTCAGCCCGGGCGACCTGAAGTTTGTCGAGCTTGATACAGGCATTGAAGAGGCGACGAACATTTTGATTGAT
TCAGGTGGCGCTGTGCTGTTGATTCGCGAGACACCCGAGTCCACTTCTGCCGTGGGCACATTCGACTATGCCGAT
CTCAATTCCTATCTCCTTTTAGCAGCGGGCCTGACACATCCGGACGAAGCACATCAAGCGTCATATGACGAGCTA
GCCAAGAAAGCCCACAACGGCGTGCCCATTCCATTAAGAGATGTGAAGAAGTTCGGTATGGAGAAGGAGCCGCTG
ATCAAGCTGCCAGCGTCGGCCAATGTCTTGGCCGCGGTTGAGATCTTTGGTGGTGGTGTTCACCGGGTTGTGGTT
GTCAATGAGTCAAATGACCAAGAAGTGGTCGGGATTTTCAGCCAGTTCCGACTGGTCAAATTCCTCTGGGAAAAT
CGCCGCAGTTTCCCGATTATTGAAGAGCTCTACCCGAGGGCTCTGAATGAGCTAGTTATTGGATCTCAGGAAGTG
ATCTCCATCAATGGTGATAAACCCCTCTCTGATGCTCTCCATGTGATGAACAATGAGGGTATGTCCTCGATCGCG
GTGGTTGATAACTACTTGAACGTGCTTGGGAATATCTCCACGGCGGATGTCAAGCTCTTGACCCGATCATCTTCA
TTGCCACTTCTGCATAACACCTGTACCCACTTTATCTCGATTATTCTATCTACACGGGGGTTGATTGAGGGTAAA
GACTCATTCCCGGTCTTCCACGTCAATCCTGGATCGACACTCGCTCACACAGTCGCAAAGATCGTGGCAACTCGA
TCGCATCGACTCTGGGTGACCGATCCGTTATCTCCCACCTCATCAGGACCGCCAACTCCATCGCAATCTTCCGTA
CACCTCCCTCTTTCCAACAGTATCAGCCCAGCTACCGGAGGTACTGCAAATTCAGAATCTTCTGAAGAAGCTGTG
ACATCTTATGCACAGCCCTCTCAATATGCCGCCCCTCACCTACCACCTCCTAACCCACCCTTCACGTACCCAGCC
GTGGCGGTCTCAGTGCCATCACCCATCTCGCATTCTATTCCCTCGTCCGCCCTAGACGGAGCCCGAGTGTCCGGA
CGCCTCGCCGGAGTGGTCAGCTTGACTGACATCCTGAACCTGCATGCCCGAGCCAGCGGGCTGAACCCGGCCGAC
CCGGCCGACTCTCGTAGCCGCCGCCGACGCAGTAGTTCGTCGAGCCAGAGTGTCCGCCGCAGCGGTGACATTGGC
CGGGAGCTTTTCAGTCGTGGTGGCATGTAA
Transcript >Pro_DTO377G3_2|g4989.t1
ATGGCAGACCACTTACATTCTCGCGAAGGATCTGATGCTTCCCTCAACAATGCATCGATTGCTTCTCCGCGATCC
AGCACCGAATCTCGCTCTCGAAATCCACTTCGCATTTCAGCAAACCACCAGCATAGACAAAGCTTGAGCGAGTCG
CTTCGCGGCCCGCCAGGTTCCCCCCGTGCACGCCGGCAGCCATCACTCCCACAGTCGGCCATCCAGAGCCTTATC
GATAATCCACCGCCACCCAAGGCTAGCAACCCTGCCTTTGTTGGTCGTGATTGGAGAGAGATATCAGTTGGGGAG
CTGGTCAGCCCGGGCGACCTGAAGTTTGTCGAGCTTGATACAGGCATTGAAGAGGCGACGAACATTTTGATTGAT
TCAGGTGGCGCTGTGCTGTTGATTCGCGAGACACCCGAGTCCACTTCTGCCGTGGGCACATTCGACTATGCCGAT
CTCAATTCCTATCTCCTTTTAGCAGCGGGCCTGACACATCCGGACGAAGCACATCAAGCGTCATATGACGAGCTA
GCCAAGAAAGCCCACAACGGCGTGCCCATTCCATTAAGAGATGTGAAGAAGTTCGGTATGGAGAAGGAGCCGCTG
ATCAAGCTGCCAGCGTCGGCCAATGTCTTGGCCGCGGTTGAGATCTTTGGTGGTGGTGTTCACCGGGTTGTGGTT
GTCAATGAGTCAAATGACCAAGAAGTGGTCGGGATTTTCAGCCAGTTCCGACTGGTCAAATTCCTCTGGGAAAAT
CGCCGCAGTTTCCCGATTATTGAAGAGCTCTACCCGAGGGCTCTGAATGAGCTAGTTATTGGATCTCAGGAAGTG
ATCTCCATCAATGGTGATAAACCCCTCTCTGATGCTCTCCATGTGATGAACAATGAGGGTATGTCCTCGATCGCG
GTGGTTGATAACTACTTGAACGTGCTTGGGAATATCTCCACGGCGGATGTCAAGCTCTTGACCCGATCATCTTCA
TTGCCACTTCTGCATAACACCTGTACCCACTTTATCTCGATTATTCTATCTACACGGGGGTTGATTGAGGGTAAA
GACTCATTCCCGGTCTTCCACGTCAATCCTGGATCGACACTCGCTCACACAGTCGCAAAGATCGTGGCAACTCGA
TCGCATCGACTCTGGGTGACCGATCCGTTATCTCCCACCTCATCAGGACCGCCAACTCCATCGCAATCTTCCGTA
CACCTCCCTCTTTCCAACAGTATCAGCCCAGCTACCGGAGGTACTGCAAATTCAGAATCTTCTGAAGAAGCTGTG
ACATCTTATGCACAGCCCTCTCAATATGCCGCCCCTCACCTACCACCTCCTAACCCACCCTTCACGTACCCAGCC
GTGGCGGTCTCAGTGCCATCACCCATCTCGCATTCTATTCCCTCGTCCGCCCTAGACGGAGCCCGAGTGTCCGGA
CGCCTCGCCGGAGTGGTCAGCTTGACTGACATCCTGAACCTGCATGCCCGAGCCAGCGGGCTGAACCCGGCCGAC
CCGGCCGACTCTCGTAGCCGCCGCCGACGCAGTAGTTCGTCGAGCCAGAGTGTCCGCCGCAGCGGTGACATTGGC
CGGGAGCTTTTCAGTCGTGGTGGCATGTAA
Gene >Pro_DTO377G3_2|g4989.t1
ATGGCAGACCACTTACATTCTCGCGAAGGATCTGATGCTTCCCTCAACAATGCATCGATTGCTTCTCCGCGATCC
AGCACCGAATCTCGCTCTCGAAATCCACTTCGCATTTCAGCAAACCACCAGCATAGACAAAGCTTGAGCGAGTCG
CTTCGCGGCCCGCCAGGTTCCCCCCGTGCACGCCGGCAGCCATCACTCCCACAGTCGGCCATCCAGAGCCTTATC
GATAATCCACCGCCACCCAAGGCTAGCAACCCTGCCTTTGTTGGTCGTGATTGGAGAGAGATATCAGTTGGGGAG
CTGGTCAGCCCGGGCGACCTGAAGTTTGTCGAGCTTGATACAGGCATTGAAGAGGCGACGAACGTGAGTACATCA
CATAGGCAGCATTCCCTGTCCTGACTAACATGCTCGTCCAACTAGATTTTGATTGATTCAGGTGGCGCTGTGCTG
TTGATTCGCGAGACACCCGAGTCCACTTCTGCCGTGGGCACATTCGACTATGCCGATCTCAATTCCTATCTCCTT
TTAGCAGCGGGCCTGACACATCCGGACGAAGCACATCAAGCGTCATATGACGAGCTAGCCAAGAAAGCCCACAAC
GGCGTGCCCATTCCATTAAGAGATGTGAAGAAGTTCGGTATGGAGAAGGAGCCGCTGATCAAGCTGCCAGCGTCG
GCCAATGTCTTGGCCGCGGTTGAGATCTTTGGTGGTGGTGTTCACCGGGTTGTGGTTGTCAATGAGTCAAATGAC
CAAGAAGTGGTCGGGATTTTCAGCCAGTTCCGACTGGTCAAATTCCTCTGGGAAAATCGCCGCAGTTTCCCGATT
ATTGAAGAGCTCTACCCGAGGGCTCTGAATGAGCTAGTTATTGGATCTCAGGAAGTGATCTCCATCAAGTGAGTT
GTTTTGGTGATCTTTAGCGCTGTCTAACCGCTAATTCGTAATTCTCAGTGGTGATAAACCCCTCTCTGATGCTCT
CCATGTGATGAACAATGAGGGTATGTCCTCGATCGCGGTGGTTGATAACTACTTGAACGTGCTTGGGAATATCTC
CACGGCGGATGTCAAGGTATGTGACGAGCCATCTTAACTGGCAAAGTTTACTCACCATTTCGTAGCTCTTGACCC
GATCATCTTCATTGCCACTTCTGCATAACACCTGTACCCACTTTATCTCGATTATTCTATCTACACGGGGGTTGA
TTGAGGGTAAAGACTCATTCCCGGTCTTCCACGTCAATCCTGGATCGACACTCGCTCACACAGTCGCAAAGATCG
TGGCAACTCGATCGCATCGGTAACTACTGCAAACTTGAGATATAAACACAAGATGTACTGACTGCTTTAGACTCT
GGGTGACCGATCCGTTATCTCCCACCTCATCAGGACCGCCAACTCCATCGCAATCTTCCGTACACCTCCCTCTTT
CCAACAGTATCAGCCCAGCTACCGGAGGTACTGCAAATTCAGAATCTTCTGAAGAAGCTGTGACATCTTATGCAC
AGCCCTCTCAATATGCCGCCCCTCACCTACCACCTCCTAACCCACCCTTCACGTACCCAGCCGTGGCGGTCTCAG
TGCCATCACCCATCTCGCATTCTATTCCCTCGTCCGCCCTAGACGGAGCCCGAGTGTCCGGACGCCTCGCCGGAG
TGGTCAGCTTGACTGACATCCTGAACCTGCATGCCCGAGCCAGCGGGCTGAACCCGGCCGACCCGGCCGACTCTC
GTAGCCGCCGCCGACGCAGTAGTTCGTCGAGCCAGAGTGTCCGCCGCAGCGGTGACATTGGCCGGGAGCTTTTCA
GTCGTGGTGGCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail