Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4980.t1
Gene name
Locationscaffold_11:226256..227088
Strand-
Gene length (bp)832
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00037 Fer4 4Fe-4S binding domain 1.3E-05 118 137
PF00037 Fer4 4Fe-4S binding domain 3.5E-08 154 175
PF12838 Fer4_7 4Fe-4S dicluster domain 7.4E-13 120 174
PF13237 Fer4_10 4Fe-4S dicluster domain 3.9E-07 118 171
PF13187 Fer4_9 4Fe-4S dicluster domain 5.2E-08 120 175
PF12800 Fer4_4 4Fe-4S binding domain 2.8E-04 119 134

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4980.t1
MAATRSVARLIAYRRPTPFGLLGSTANFSSSTYRAATPAGPPQAGFRLPPPKHWDQSSESALDKASKYFLMAEIF
RGMYVVLEQFFRPPYTIFYPFEKGPISPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAEEREDGSRRT
TRYDIDMTKCIYCGYCQESCPVDAIVETSNAEYATETREELLYNKEKLLSNGDKWEPEIAASARADAPYR*
Coding >Pro_DTO377G3_2|g4980.t1
ATGGCCGCCACCCGCTCGGTCGCGAGGCTAATCGCCTACCGTCGGCCGACCCCCTTCGGATTGCTGGGCTCAACC
GCAAACTTCTCTTCTTCGACGTACCGCGCAGCAACCCCAGCGGGACCCCCTCAGGCCGGGTTCCGCCTGCCCCCG
CCCAAGCACTGGGATCAGAGCTCCGAGTCCGCCTTGGACAAGGCCAGCAAATATTTCCTCATGGCAGAGATCTTC
CGCGGCATGTACGTGGTGCTTGAGCAGTTTTTCAGACCACCTTACACCATCTTCTACCCTTTCGAGAAGGGTCCT
ATCTCCCCCCGTTTCCGTGGCGAACACGCCCTCCGTCGCTATCCCACTGGTGAAGAGCGCTGCATTGCTTGCAAG
CTCTGTGAGGCTATCTGCCCGGCCCAAGCTATTACGATTGAGGCCGAAGAGCGTGAGGATGGAAGCCGCCGCACG
ACCCGTTACGATATTGATATGACCAAGTGCATTTACTGTGGCTACTGCCAGGAGAGCTGCCCTGTGGATGCCATC
GTTGAGACTTCCAACGCCGAGTATGCCACCGAGACCCGCGAGGAGCTTCTGTACAACAAGGAGAAGCTCCTCTCC
AATGGTGATAAGTGGGAGCCTGAGATTGCAGCTAGTGCTCGTGCAGATGCTCCCTACCGATAA
Transcript >Pro_DTO377G3_2|g4980.t1
ATGGCCGCCACCCGCTCGGTCGCGAGGCTAATCGCCTACCGTCGGCCGACCCCCTTCGGATTGCTGGGCTCAACC
GCAAACTTCTCTTCTTCGACGTACCGCGCAGCAACCCCAGCGGGACCCCCTCAGGCCGGGTTCCGCCTGCCCCCG
CCCAAGCACTGGGATCAGAGCTCCGAGTCCGCCTTGGACAAGGCCAGCAAATATTTCCTCATGGCAGAGATCTTC
CGCGGCATGTACGTGGTGCTTGAGCAGTTTTTCAGACCACCTTACACCATCTTCTACCCTTTCGAGAAGGGTCCT
ATCTCCCCCCGTTTCCGTGGCGAACACGCCCTCCGTCGCTATCCCACTGGTGAAGAGCGCTGCATTGCTTGCAAG
CTCTGTGAGGCTATCTGCCCGGCCCAAGCTATTACGATTGAGGCCGAAGAGCGTGAGGATGGAAGCCGCCGCACG
ACCCGTTACGATATTGATATGACCAAGTGCATTTACTGTGGCTACTGCCAGGAGAGCTGCCCTGTGGATGCCATC
GTTGAGACTTCCAACGCCGAGTATGCCACCGAGACCCGCGAGGAGCTTCTGTACAACAAGGAGAAGCTCCTCTCC
AATGGTGATAAGTGGGAGCCTGAGATTGCAGCTAGTGCTCGTGCAGATGCTCCCTACCGATAA
Gene >Pro_DTO377G3_2|g4980.t1
ATGGCCGCCACCCGCTCGGTCGCGAGGCTAATCGCCTACCGTCGGCCGACCCCCTTCGGATTGCTGGGCTCAACC
GCAAACTTCTCTTCTTCGACGTACCGCGCAGCAACCCCAGCGGGACCCCCTCAGGCCGGGTTCCGCCTGCCCCCG
CCCAAGCACTGGGATCAGAGCTCCGAGTCCGCCTTGGACAAGGCCAGCAAATATTTCCTCATGGCAGAGATCTTC
CGCGGCATGTACGTGGTGCTTGAGCAGTTTTTCAGACCACCGTAAGTCCTTGTCCCACTCAACCTTGCCGGCGAT
ACGGATCGCAATCCAAAATCAATGGCATCGAAATATATCAACTAATTGCGTTGCAATGTTCCAGTTACACCATCT
TCTACCCTTTCGAGAAGGGTCCTATCTCCCCCCGTTTCCGTGGCGAACACGCCCTCCGTCGCTATCCCACTGGTG
AAGAGCGCTGCATTGCTTGCAAGCTCTGTGAGGCTATCTGCCCGGCCCAAGCTATTACGATTGAGGCCGAAGAGC
GTGAGGATGGAAGCCGCCGCACGACCCGTTACGATATTGATATGACCAAGTGCATTTACTGTGGCTACTGCCAGG
AGAGCTGCCCTGTGGATGCCATCGTTGAGAGTGAGTTCAACACCCTCAGGTTACATCTCAATTGACATTCAAGCC
GGATTACTAACATTTTTTTCTTACAGCTTCCAACGCCGAGTATGCCACCGAGACCCGCGAGGAGCTTCTGTACAA
CAAGGAGAAGCTCCTCTCCAATGGTGATAAGTGGGAGCCTGAGATTGCAGCTAGTGCTCGTGCAGATGCTCCCTA
CCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail