Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4958.t1
Gene name
Locationscaffold_11:171595..173666
Strand-
Gene length (bp)2071
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00209 SNF Sodium:neurotransmitter symporter family 2.7E-72 25 449

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 32 49 17
2 64 86 22
3 107 129 22
4 178 200 22
5 213 235 22
6 262 284 22
7 296 318 22
8 349 371 22
9 391 413 22
10 423 445 22
11 457 479 22
12 483 502 19
13 556 575 19
14 585 607 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4958.t1
MVLAQYLKKVVAWIAPPPQKSEDGRDQWPSRAAFLLAAMGGCAGQGNLLRYPSVVYNNYGLQWFIPYLLAVFAIA
IPALILEIAIGQAYRGGTMIAFNNINHRLKGVGMGPILVSFVVVQYFTVNLAWIMNYFRNSFRSPLPWEGRIEEF
YMGDVVANVDPAVGNLTAGNGAVAHYTVYPGIALIGETVGWSAFIWFLIWISIFRGVGLTGRVVYWTMGLPIVTT
IIIVGRSCSLENAGEGIRLLWATWRSDQLASGTVWQTAVGQVFFSTGIGFGYFTSYASYNSKHSNAVMDAFLICG
SNILFENFAAFAVFGVIGYLRRWPQDGERLGAFVVGFLTLPEAVLHMPGANWWAILLFFTLVVLGFSSAFVMLDA
VATLAVDSGMKMSRPMIVTSLTIISFLMSLPYCTQFGFYLLDGIDRWINNVALIFVVWSELVGATTVYRWHDVVS
QTGLPAFVVYNFGYFGGQIVGVAVAHGISNPSAGAGAGFGLYIVCSILSVLVATTPAIKAASFWGRNPLLARFWY
LAFYSGNQLRRDLNGVVGGNGNWNIPRFWPILLRYVSAPILAIVFSFAYPEFYTLRYDPMMIAGFILAHFCLLLT
LLGVVFPRYYDVFIPPHRRAEGTEIMTANQPKEHDFVPDVGVFDFESGMPESISGRKSSDKLDSVHSTLPKL*
Coding >Pro_DTO377G3_2|g4958.t1
ATGGTACTCGCCCAGTATCTGAAGAAGGTCGTGGCCTGGATTGCTCCTCCTCCACAAAAATCCGAAGATGGACGT
GATCAATGGCCCTCTCGGGCGGCTTTCCTGTTGGCCGCCATGGGAGGCTGCGCCGGTCAGGGAAATCTGCTGCGA
TACCCGTCGGTAGTCTACAATAACTATGGGCTGCAATGGTTTATCCCCTACCTATTAGCTGTGTTCGCCATTGCC
ATTCCGGCCCTTATTCTCGAGATTGCGATTGGACAAGCCTATCGTGGCGGGACGATGATCGCGTTCAATAATATC
AACCATCGACTGAAAGGCGTTGGCATGGGCCCGATTTTGGTCAGTTTTGTCGTCGTGCAATACTTTACGGTCAAT
TTGGCGTGGATCATGAACTATTTCCGCAACTCCTTCCGGAGCCCATTGCCATGGGAGGGCAGAATCGAGGAATTT
TATATGGGCGATGTCGTCGCCAATGTCGATCCAGCCGTGGGTAATCTCACTGCTGGCAATGGTGCCGTTGCCCAC
TATACCGTGTACCCCGGCATTGCCCTCATCGGTGAGACGGTCGGCTGGAGCGCATTTATTTGGTTTCTCATATGG
ATCTCCATCTTCCGTGGAGTGGGCCTGACGGGTCGCGTGGTCTACTGGACGATGGGTCTGCCGATTGTCACCACC
ATTATTATCGTCGGTCGCTCGTGTTCACTGGAAAATGCGGGCGAGGGTATCCGACTCTTATGGGCGACATGGAGA
AGCGATCAACTAGCCTCGGGCACTGTCTGGCAAACCGCCGTCGGACAGGTCTTCTTTTCCACCGGCATTGGTTTC
GGCTATTTCACTTCATATGCCTCCTATAATTCCAAACACTCCAATGCTGTCATGGACGCATTTCTCATCTGCGGA
AGTAACATCCTATTCGAAAACTTTGCTGCCTTTGCCGTGTTTGGTGTCATCGGCTACCTCCGACGTTGGCCACAA
GATGGCGAGAGATTGGGTGCATTCGTTGTCGGCTTCCTGACCCTCCCCGAGGCTGTTCTTCACATGCCTGGTGCG
AATTGGTGGGCTATCCTTCTATTCTTTACCCTGGTGGTTCTCGGTTTTAGTTCGGCCTTTGTGATGCTCGACGCG
GTGGCCACGTTAGCCGTGGATTCGGGCATGAAAATGTCGCGGCCAATGATTGTGACTAGTCTCACGATAATCTCA
TTCCTTATGAGTTTGCCATACTGCACGCAATTTGGATTCTACCTGCTGGATGGAATCGACCGATGGATTAACAAT
GTGGCATTGATCTTTGTTGTCTGGTCGGAGCTTGTCGGTGCAACCACGGTTTATCGCTGGCACGACGTGGTGAGC
CAGACAGGGCTGCCTGCTTTTGTTGTGTATAATTTCGGATACTTTGGTGGCCAGATTGTCGGAGTCGCCGTCGCA
CACGGTATCTCGAATCCATCAGCTGGTGCTGGCGCCGGGTTTGGGTTGTATATCGTCTGTTCAATTCTTTCCGTC
CTCGTCGCCACGACCCCGGCTATCAAAGCCGCCAGTTTCTGGGGGCGGAACCCTCTTCTCGCCCGATTTTGGTAT
CTAGCATTCTACTCGGGTAATCAATTGAGACGCGACCTGAACGGTGTCGTTGGCGGTAATGGAAACTGGAACATT
CCTCGTTTCTGGCCCATTCTACTCCGGTACGTCAGCGCGCCTATTCTGGCCATTGTGTTCAGCTTCGCGTATCCT
GAATTCTATACCTTGCGATACGACCCGATGATGATCGCCGGGTTTATTTTGGCGCACTTCTGTTTGCTCTTAACT
CTGCTCGGTGTGGTATTTCCGCGATACTACGATGTCTTTATCCCACCGCACCGGAGGGCCGAGGGCACCGAAATC
ATGACCGCCAATCAGCCTAAGGAACACGACTTTGTGCCAGATGTCGGGGTGTTTGACTTTGAATCCGGCATGCCA
GAGTCGATTTCGGGCCGGAAGAGTTCTGATAAGTTAGATAGTGTACATTCGACTCTGCCGAAGCTATAG
Transcript >Pro_DTO377G3_2|g4958.t1
ATGGTACTCGCCCAGTATCTGAAGAAGGTCGTGGCCTGGATTGCTCCTCCTCCACAAAAATCCGAAGATGGACGT
GATCAATGGCCCTCTCGGGCGGCTTTCCTGTTGGCCGCCATGGGAGGCTGCGCCGGTCAGGGAAATCTGCTGCGA
TACCCGTCGGTAGTCTACAATAACTATGGGCTGCAATGGTTTATCCCCTACCTATTAGCTGTGTTCGCCATTGCC
ATTCCGGCCCTTATTCTCGAGATTGCGATTGGACAAGCCTATCGTGGCGGGACGATGATCGCGTTCAATAATATC
AACCATCGACTGAAAGGCGTTGGCATGGGCCCGATTTTGGTCAGTTTTGTCGTCGTGCAATACTTTACGGTCAAT
TTGGCGTGGATCATGAACTATTTCCGCAACTCCTTCCGGAGCCCATTGCCATGGGAGGGCAGAATCGAGGAATTT
TATATGGGCGATGTCGTCGCCAATGTCGATCCAGCCGTGGGTAATCTCACTGCTGGCAATGGTGCCGTTGCCCAC
TATACCGTGTACCCCGGCATTGCCCTCATCGGTGAGACGGTCGGCTGGAGCGCATTTATTTGGTTTCTCATATGG
ATCTCCATCTTCCGTGGAGTGGGCCTGACGGGTCGCGTGGTCTACTGGACGATGGGTCTGCCGATTGTCACCACC
ATTATTATCGTCGGTCGCTCGTGTTCACTGGAAAATGCGGGCGAGGGTATCCGACTCTTATGGGCGACATGGAGA
AGCGATCAACTAGCCTCGGGCACTGTCTGGCAAACCGCCGTCGGACAGGTCTTCTTTTCCACCGGCATTGGTTTC
GGCTATTTCACTTCATATGCCTCCTATAATTCCAAACACTCCAATGCTGTCATGGACGCATTTCTCATCTGCGGA
AGTAACATCCTATTCGAAAACTTTGCTGCCTTTGCCGTGTTTGGTGTCATCGGCTACCTCCGACGTTGGCCACAA
GATGGCGAGAGATTGGGTGCATTCGTTGTCGGCTTCCTGACCCTCCCCGAGGCTGTTCTTCACATGCCTGGTGCG
AATTGGTGGGCTATCCTTCTATTCTTTACCCTGGTGGTTCTCGGTTTTAGTTCGGCCTTTGTGATGCTCGACGCG
GTGGCCACGTTAGCCGTGGATTCGGGCATGAAAATGTCGCGGCCAATGATTGTGACTAGTCTCACGATAATCTCA
TTCCTTATGAGTTTGCCATACTGCACGCAATTTGGATTCTACCTGCTGGATGGAATCGACCGATGGATTAACAAT
GTGGCATTGATCTTTGTTGTCTGGTCGGAGCTTGTCGGTGCAACCACGGTTTATCGCTGGCACGACGTGGTGAGC
CAGACAGGGCTGCCTGCTTTTGTTGTGTATAATTTCGGATACTTTGGTGGCCAGATTGTCGGAGTCGCCGTCGCA
CACGGTATCTCGAATCCATCAGCTGGTGCTGGCGCCGGGTTTGGGTTGTATATCGTCTGTTCAATTCTTTCCGTC
CTCGTCGCCACGACCCCGGCTATCAAAGCCGCCAGTTTCTGGGGGCGGAACCCTCTTCTCGCCCGATTTTGGTAT
CTAGCATTCTACTCGGGTAATCAATTGAGACGCGACCTGAACGGTGTCGTTGGCGGTAATGGAAACTGGAACATT
CCTCGTTTCTGGCCCATTCTACTCCGGTACGTCAGCGCGCCTATTCTGGCCATTGTGTTCAGCTTCGCGTATCCT
GAATTCTATACCTTGCGATACGACCCGATGATGATCGCCGGGTTTATTTTGGCGCACTTCTGTTTGCTCTTAACT
CTGCTCGGTGTGGTATTTCCGCGATACTACGATGTCTTTATCCCACCGCACCGGAGGGCCGAGGGCACCGAAATC
ATGACCGCCAATCAGCCTAAGGAACACGACTTTGTGCCAGATGTCGGGGTGTTTGACTTTGAATCCGGCATGCCA
GAGTCGATTTCGGGCCGGAAGAGTTCTGATAAGTTAGATAGTGTACATTCGACTCTGCCGAAGCTATAG
Gene >Pro_DTO377G3_2|g4958.t1
ATGGTACTCGCCCAGTATCTGAAGAAGGTCGTGGCCTGGATTGCTCCTCCTCCACAAAAATCCGAAGATGGACGT
GATCAATGGCCCTCTCGGGCGGCTTTCCTGTTGGCCGCCATGGGAGGCTGCGCCGGTCAGGGAAATCTGCTGCGA
TACCCGTCGGTAGTCTACAATAACTATGGGCTGCAATGGTTTATCCCCTACCTATTAGCTGTGTTCGCCATTGCC
ATTCCGGCCCTTATTCTCGAGATTGCGATTGGACAAGCCTATCGTGGCGGGACGATGATCGCGTTCAATAATATC
AACCATCGACTGAAAGGCGTTGGCATGGGCCCGATTTTGGTCAGTTTTGTCGTCGTGCAATACTTTACGGTCAAT
TTGGCGTGGATCATGAACTATTTCCGCAACTCCTTCCGGAGCCCATTGCCATGGGAGGGCAGAATCGAGGAATTT
TATATGGGCGATGTCGTCGCCAATGTCGATCCAGCCGTGGGTAATCTCACTGCTGGCAATGGTGCCGTTGCCCAC
TATACCGTGTACCCCGGCATTGCCCTCATCGGTGAGACGGTCGGCTGGAGCGCATTTATTTGGTTTCTCATATGG
ATCTCCATCTTCCGTGGAGTGGGCCTGACGGGTCGCGTGGTCTACTGGACGATGGGTCTGCCGATTGTCACCACC
ATTATTATCGTCGGTCGCTCGTGTTCACTGGAAAATGCGGGCGAGGGTATCCGACTCTTATGGGCGACATGGAGA
AGCGATCAACTAGCCTCGGGCACTGTCTGGCAAACCGCCGTCGGACAGGTCTTCTTTTCCACCGGCATTGGTTTC
GGCTATTTCACTTCATATGCCTCCTATAATTCCAAACACTCCAATGCTGTCATGGACGCATTTCTCATCTGCGGA
AGTAACATCCTATTCGAAAACTTTGCTGCCTTTGCCGTGTTTGGTGTCATCGGCTACCTCCGACGTTGGCCACAA
GATGGCGAGAGATTGGGTGCATTCGTTGTCGGCTTCCTGACCCTCCCCGAGGCTGTTCTTCACATGCCTGGTGCG
AATTGGTGGGCTATCCTTCTATTCTTTACCCTGGTGGTTCTCGGTTTTAGTTCGGCCTTTGTGATGCTCGACGCG
GTGGCCACGTTAGCCGTGGATTCGGGCATGAAAATGTCGCGGCCAATGATTGTGACTAGTCTCACGATAATCTCA
TTCCTTATGAGTTTGCCATACTGCACGCAATTTGGATTCTACCTGCTGGATGGAATCGACCGATGGATTAACAAT
GTGGCATTGATCTTTGTTGTCTGGTCGGAGCTTGTCGGTGCAACCACGGTTTATCGCTGGCACGACGTGGTGAGC
CAGACAGGGCTGCCTGCTTTTGTTGTGTATAATTTCGGATACTTTGGTGGCCAGATTGTCGGAGTCGCCGTCGCA
CACGGTATCTCGAATCCATCAGCTGGTGCTGGCGCCGGGTTTGGGTTGTATATCGTCTGTTCAATTCTTTCCGTC
CTCGTCGCCACGACCCCGGCTATCAAAGCCGCCAGTTTCTGGGGGCGGAACCCTCTTCTCGCCCGATTTTGGTAT
CTAGCATTCTACTCGGTATGTCCCCACTGCTAACAAATCCAGCACCAACGGAAACTAATATTTGTAGGGTAATCA
ATTGAGACGCGACCTGAACGGTGTCGTTGGCGGTAATGGAAACTGGAACATTCCTCGTTTCTGGCCCATTCTACT
CCGGTACGTCAGCGCGCCTATTCTGGCCATTGTGTTCAGCTTCGCGTATCCTGAATTCTATACCTTGCGATACGA
CCCGATGATGATCGCCGGGTTTATTTTGGCGCACTTCTGTTTGCTCTTAACTCTGCTCGGTGTGGTATTTCCGCG
ATACTACGATGTCTTTATCCCACCGCACCGGAGGGCCGAGGGCACCGAAATCATGACCGCCAATCAGCCTAAGGA
ACACGACTTTGTGCCAGATGTCGGGGTGTTTGACTTTGAATCCGGCATGCCAGAGTCGATTTCGGGCCGGAAGAG
TTCTGATAAGTTAGATAGTGTACATTCGACTCTGCCGAAGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail