Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4950.t1
Gene name
Locationscaffold_11:154867..156521
Strand-
Gene length (bp)1654
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01474 DAHP_synth_2 Class-II DAHP synthetase family 6.1E-200 4 450

GO

GO Term Description Terminal node
GO:0009073 aromatic amino acid family biosynthetic process Yes
GO:0003849 3-deoxy-7-phosphoheptulonate synthase activity Yes
GO:0071704 organic substance metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0016740 transferase activity No
GO:0019752 carboxylic acid metabolic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0009072 aromatic amino acid family metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016053 organic acid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4950.t1
MAEWSPSSWTQKPIKQDVIYEDAQGLQDSLQKLQKLPPLVTTQEIINLKKNLRNVALGKAFVLQGGDCAELFDYC
SQEMIEAKVKLLLQMSLVLIWGANKPVIRIARIAGQFAKPRSSPTEVINGVEMPSFRGDNINGFAADPVSRQPDP
SRLVSAYFHSAATLNYLRASLSSGLADLHSPLDWGLGHVITPSIKEQYAKTVRAVKDALRFMHTVGIDKDRGFET
ADIFTSHEGLSLEYEQSLTRLLRHPARPGSTTTAPETGYYATSGHFLWIGDRTRQLGGAHIEFFRGIANPVGIKI
GPSMAADELVQLLDVVNPDREVGKVTLISRYGAGKIATFLPGHIAAVQASGHIPVWQCDPMHGNTQSTPSGVKTR
HFTDILSELKQALEIHRAAGSFLGGMHLELTGEAVTECVGGAGGLTEDGLGERYTTFCDPRLNEKQALELAFLVA
GFYREESEE*
Coding >Pro_DTO377G3_2|g4950.t1
ATGGCCGAATGGAGCCCTAGTTCCTGGACACAAAAGCCCATCAAGCAAGATGTCATCTACGAGGATGCTCAAGGG
TTGCAAGACTCATTGCAGAAACTACAGAAGCTTCCTCCACTTGTGACCACACAAGAAATCATCAATCTCAAGAAG
AACCTACGAAATGTCGCTTTGGGCAAAGCATTCGTTCTACAGGGTGGTGACTGTGCCGAGCTCTTCGACTATTGC
AGCCAAGAAATGATCGAAGCCAAAGTGAAGCTCTTGTTGCAAATGAGTTTGGTTCTCATCTGGGGCGCCAATAAG
CCCGTCATCCGTATTGCCCGGATTGCAGGCCAGTTTGCAAAGCCACGCTCAAGTCCAACAGAGGTCATCAACGGA
GTGGAAATGCCCTCTTTCCGCGGCGACAATATCAATGGCTTCGCAGCAGACCCTGTATCCCGCCAACCGGATCCA
TCGCGTCTAGTCTCAGCCTACTTCCACTCCGCGGCGACTCTGAATTATCTCCGCGCCTCCCTGTCCTCAGGCCTG
GCAGACCTGCACTCCCCACTAGACTGGGGCCTGGGCCATGTAATCACGCCCTCAATCAAAGAGCAATACGCCAAA
ACCGTACGCGCAGTAAAGGATGCCCTGCGCTTCATGCACACGGTAGGAATTGATAAAGACCGCGGCTTCGAGACA
GCCGACATTTTCACCAGCCACGAAGGCCTCTCCCTAGAATACGAGCAGAGTCTAACCCGGCTCCTCCGCCACCCA
GCGCGCCCAGGAAGCACCACCACGGCTCCCGAAACCGGCTATTACGCAACATCCGGCCACTTCCTCTGGATCGGC
GACCGGACCCGCCAACTCGGCGGTGCGCATATCGAGTTCTTCCGTGGTATCGCTAACCCCGTCGGAATCAAGATC
GGGCCCAGCATGGCGGCAGATGAGCTGGTGCAGCTGCTGGATGTCGTGAACCCGGATCGCGAAGTCGGGAAGGTG
ACTCTGATCTCGCGATACGGCGCTGGGAAAATCGCCACTTTCCTCCCTGGTCATATTGCCGCTGTGCAGGCCTCC
GGTCATATCCCTGTCTGGCAGTGTGACCCTATGCATGGCAATACGCAGAGCACACCGTCTGGTGTGAAGACCCGC
CACTTCACGGATATCTTGTCTGAGTTGAAGCAGGCGTTGGAAATCCACCGCGCTGCAGGGTCGTTCCTTGGTGGT
ATGCATCTAGAACTTACCGGAGAGGCTGTTACCGAGTGTGTGGGTGGTGCTGGTGGGCTGACGGAGGATGGACTT
GGCGAGCGGTATACGACATTCTGTGATCCACGCTTGAACGAGAAGCAAGCTTTGGAGCTGGCTTTCTTGGTTGCT
GGATTCTATCGTGAAGAGTCTGAGGAGTAA
Transcript >Pro_DTO377G3_2|g4950.t1
ATGGCCGAATGGAGCCCTAGTTCCTGGACACAAAAGCCCATCAAGCAAGATGTCATCTACGAGGATGCTCAAGGG
TTGCAAGACTCATTGCAGAAACTACAGAAGCTTCCTCCACTTGTGACCACACAAGAAATCATCAATCTCAAGAAG
AACCTACGAAATGTCGCTTTGGGCAAAGCATTCGTTCTACAGGGTGGTGACTGTGCCGAGCTCTTCGACTATTGC
AGCCAAGAAATGATCGAAGCCAAAGTGAAGCTCTTGTTGCAAATGAGTTTGGTTCTCATCTGGGGCGCCAATAAG
CCCGTCATCCGTATTGCCCGGATTGCAGGCCAGTTTGCAAAGCCACGCTCAAGTCCAACAGAGGTCATCAACGGA
GTGGAAATGCCCTCTTTCCGCGGCGACAATATCAATGGCTTCGCAGCAGACCCTGTATCCCGCCAACCGGATCCA
TCGCGTCTAGTCTCAGCCTACTTCCACTCCGCGGCGACTCTGAATTATCTCCGCGCCTCCCTGTCCTCAGGCCTG
GCAGACCTGCACTCCCCACTAGACTGGGGCCTGGGCCATGTAATCACGCCCTCAATCAAAGAGCAATACGCCAAA
ACCGTACGCGCAGTAAAGGATGCCCTGCGCTTCATGCACACGGTAGGAATTGATAAAGACCGCGGCTTCGAGACA
GCCGACATTTTCACCAGCCACGAAGGCCTCTCCCTAGAATACGAGCAGAGTCTAACCCGGCTCCTCCGCCACCCA
GCGCGCCCAGGAAGCACCACCACGGCTCCCGAAACCGGCTATTACGCAACATCCGGCCACTTCCTCTGGATCGGC
GACCGGACCCGCCAACTCGGCGGTGCGCATATCGAGTTCTTCCGTGGTATCGCTAACCCCGTCGGAATCAAGATC
GGGCCCAGCATGGCGGCAGATGAGCTGGTGCAGCTGCTGGATGTCGTGAACCCGGATCGCGAAGTCGGGAAGGTG
ACTCTGATCTCGCGATACGGCGCTGGGAAAATCGCCACTTTCCTCCCTGGTCATATTGCCGCTGTGCAGGCCTCC
GGTCATATCCCTGTCTGGCAGTGTGACCCTATGCATGGCAATACGCAGAGCACACCGTCTGGTGTGAAGACCCGC
CACTTCACGGATATCTTGTCTGAGTTGAAGCAGGCGTTGGAAATCCACCGCGCTGCAGGGTCGTTCCTTGGTGGT
ATGCATCTAGAACTTACCGGAGAGGCTGTTACCGAGTGTGTGGGTGGTGCTGGTGGGCTGACGGAGGATGGACTT
GGCGAGCGGTATACGACATTCTGTGATCCACGCTTGAACGAGAAGCAAGCTTTGGAGCTGGCTTTCTTGGTTGCT
GGATTCTATCGTGAAGAGTCTGAGGAGTAA
Gene >Pro_DTO377G3_2|g4950.t1
ATGGCCGAATGGAGCCCTAGTTGTAAGAGCAAAAATCTGTAACTCTGTTTCACATTTGATCCAATATCACTGACT
ATATTTAGCCTGGACACAAAAGCCCATCAAGCAAGATGTCATCTACGAGGATGCTCAAGGGTTGCAAGACTCATT
GCAGAAACTACAGAAGCTTCCTCCACTTGTGACCACACAAGAAGTATGTCTTTCCTTCAGACTGGATCTTAGCTA
TTATATTGACCTGGTTTGAAGATCATCAATCTCAAGAAGAACCTACGAAATGTCGCTTTGGGCAAAGCATTCGTT
CTACAGGGTGGTATGTCGCACAAGAAAAGCATATCCCCCAAACAAGCACTAAGCATTCTGTCTAGGTGACTGTGC
CGAGCTCTTCGACTATTGCAGCCAAGAAATGATCGAAGCCAAAGTGAAGCTCTTGTTGCAAATGAGTTTGGTTCT
CATCTGGGGTATGTCAGACCCCCACAAAAAGCAAAGAAACATGACAACTAATCCACCAATAGGCGCCAATAAGCC
CGTCATCCGTATTGCCCGGATTGCAGGCCAGTTTGCAAAGTATGTTTTTCATTCATTAATTCATGACCACAAAAT
TAATAACAAAACTAGGCCACGCTCAAGTCCAACAGAGGTCATCAACGGAGTGGAAATGCCCTCTTTCCGCGGCGA
CAATATCAATGGCTTCGCAGCAGACCCTGTATCCCGCCAACCGGATCCATCGCGTCTAGTCTCAGCCTACTTCCA
CTCCGCGGCGACTCTGAATTATCTCCGCGCCTCCCTGTCCTCAGGCCTGGCAGACCTGCACTCCCCACTAGACTG
GGGCCTGGGCCATGTAATCACGCCCTCAATCAAAGAGCAATACGCCAAAACCGTACGCGCAGTAAAGGATGCCCT
GCGCTTCATGCACACGGTAGGAATTGATAAAGACCGCGGCTTCGAGACAGCCGACATTTTCACCAGCCACGAAGG
CCTCTCCCTAGAATACGAGCAGAGTCTAACCCGGCTCCTCCGCCACCCAGCGCGCCCAGGAAGCACCACCACGGC
TCCCGAAACCGGCTATTACGCAACATCCGGCCACTTCCTCTGGATCGGCGACCGGACCCGCCAACTCGGCGGTGC
GCATATCGAGTTCTTCCGTGGTATCGCTAACCCCGTCGGAATCAAGATCGGGCCCAGCATGGCGGCAGATGAGCT
GGTGCAGCTGCTGGATGTCGTGAACCCGGATCGCGAAGTCGGGAAGGTGACTCTGATCTCGCGATACGGCGCTGG
GAAAATCGCCACTTTCCTCCCTGGTCATATTGCCGCTGTGCAGGCCTCCGGTCATATCCCTGTCTGGCAGTGTGA
CCCTATGCATGGCAATACGCAGAGCACACCGTCTGGTGTGAAGACCCGCCACTTCACGGATATCTTGTCTGAGTT
GAAGCAGGCGTTGGAAATCCACCGCGCTGCAGGGTCGTTCCTTGGTGGTATGCATCTAGAACTTACCGGAGAGGC
TGTTACCGAGTGTGTGGGTGGTGCTGGTGGGCTGACGGAGGATGGACTTGGCGAGCGGTATACGACATTCTGTGA
TCCACGCTTGAACGAGAAGCAAGCTTTGGAGCTGGCTTTCTTGGTTGCTGGATTCTATCGTGAAGAGTCTGAGGA
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail