Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4922.t1
Gene name
Locationscaffold_11:68560..70136
Strand-
Gene length (bp)1576
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04757 Pex2_Pex12 Pex2 / Pex12 amino terminal region 1.1E-36 84 283

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 42.65 25.06 60.23
5d_25C Five days - 25 degrees Celsius 50.86 30.35 71.37
7d_25C Seven days - 25 degrees Celsius 57.28 34.50 80.06
10d_25C Ten days - 25 degrees Celsius 69.36 42.15 96.57
7d_15C Seven days - 15 degrees Celsius 51.77 30.62 72.93
7d_30C Seven days - 30 degrees Celsius 48.04 28.31 67.77

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.504261 no
3d_25C 7d_25C 0.206335 no
3d_25C 7d_15C 0.457911 no
3d_25C 7d_30C 0.685447 no
3d_25C 10d_25C 0.020393 yes
5d_25C 7d_25C 0.685621 no
5d_25C 7d_15C 0.961507 no
5d_25C 7d_30C 0.864392 no
5d_25C 10d_25C 0.174239 no
7d_25C 7d_15C 0.741981 no
7d_25C 7d_30C 0.510675 no
7d_25C 10d_25C 0.451938 no
7d_15C 7d_30C 0.819374 no
7d_15C 10d_25C 0.206795 no
7d_30C 10d_25C 0.096455 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4922.t1
MSSTNFAAAQERVLQRRRQREAEARARYAAQQRASPISPATVQRLPYPLNRLPGSGWRIWNSIKGREGTRPAFRV
GQVDAELLDEELLGLLKGQVGDALKYFGPQMREDWSHEILFALRAMLFKLSIWDHNASYGAALQGLKYTDSRSKG
PVFSSPTKWQKGIYGLLTVGGRYAWDKWESWLVGQEGGYDEPSPDIRMLSRLTDMISTSHSIAAFVSFLVFLVNG
RYRTLVDRILRIRLTPPSAQASREVSFEYLNRQLVWHAFTEFLLFLLPLVGIGRWRRWISRVWKKMVNSVRSSGD
DDETPEKQGELAFLPERTCAICYYDQNPTTTTESDTIAASASGGIVGSAQTDITNPYETVPCGCIYCFVCIVQKL
EAEEGQGWSCLRCGEIVKKCQPWNGDVLEEARSQPGTGKIVGFAIDGELNGETRGTDLHQGGSSNKSSPLQEISA
DEALQHSEQWSTIEKEAEDDGRRGTNEDEGPNPAAM*
Coding >Pro_DTO377G3_2|g4922.t1
ATGAGTTCAACAAACTTCGCCGCTGCACAAGAACGAGTTCTTCAACGTCGTCGCCAGCGTGAGGCGGAAGCGCGC
GCCCGCTATGCAGCACAGCAGCGGGCCTCTCCGATCAGCCCGGCCACCGTCCAGCGTCTGCCATATCCATTGAAT
CGATTACCCGGTTCGGGGTGGCGGATATGGAATTCCATCAAGGGCCGGGAAGGCACGCGCCCCGCATTTCGAGTG
GGCCAGGTGGACGCTGAATTGTTGGATGAGGAGTTGCTTGGGCTGCTGAAGGGCCAGGTCGGGGATGCTCTCAAA
TACTTCGGGCCTCAAATGCGCGAAGATTGGTCACATGAGATTCTGTTCGCGTTACGGGCCATGCTCTTTAAACTA
TCAATATGGGATCATAACGCATCGTATGGTGCGGCACTACAAGGCCTCAAATACACCGATAGTCGAAGCAAAGGA
CCCGTTTTCTCTTCTCCGACAAAATGGCAGAAGGGTATTTATGGCTTATTGACGGTTGGAGGGCGATATGCTTGG
GACAAGTGGGAGAGCTGGTTGGTCGGACAAGAAGGTGGCTATGACGAGCCATCACCGGACATCCGAATGCTGTCG
CGACTAACAGACATGATCTCGACATCGCACTCGATTGCTGCCTTCGTCTCTTTCCTGGTATTCCTAGTGAATGGC
CGATACCGTACCTTGGTCGATCGCATCCTTCGAATCCGCCTTACTCCACCGTCTGCGCAGGCTAGCCGGGAAGTA
TCCTTTGAGTATTTAAACCGTCAACTAGTTTGGCATGCTTTTACCGAATTCCTTCTTTTCCTCCTTCCTCTTGTT
GGAATTGGCCGCTGGCGGCGATGGATATCCCGGGTCTGGAAAAAGATGGTCAATTCTGTCCGGTCAAGCGGCGAT
GACGACGAGACCCCCGAAAAACAAGGAGAGCTGGCCTTCCTCCCAGAGCGAACCTGTGCTATCTGCTACTACGAT
CAGAACCCCACCACAACGACCGAAAGCGATACCATAGCCGCCTCTGCGTCAGGGGGTATTGTAGGATCGGCGCAA
ACTGATATCACAAACCCATATGAGACCGTCCCTTGCGGCTGTATCTATTGTTTCGTCTGTATTGTGCAGAAACTG
GAAGCGGAAGAAGGCCAGGGATGGTCTTGCCTCCGGTGTGGTGAAATTGTCAAGAAGTGCCAACCTTGGAATGGC
GATGTGCTAGAAGAGGCGCGGTCGCAGCCTGGAACTGGGAAGATTGTTGGCTTTGCCATTGACGGTGAACTGAAT
GGCGAGACCCGTGGGACAGATCTTCATCAAGGGGGCTCATCAAATAAGTCTAGCCCATTGCAAGAGATCAGTGCC
GATGAAGCCCTGCAGCATTCAGAGCAATGGTCCACCATTGAGAAAGAGGCAGAAGATGATGGCAGAAGAGGTACG
AACGAGGATGAGGGCCCAAACCCTGCTGCGATGTGA
Transcript >Pro_DTO377G3_2|g4922.t1
ATGAGTTCAACAAACTTCGCCGCTGCACAAGAACGAGTTCTTCAACGTCGTCGCCAGCGTGAGGCGGAAGCGCGC
GCCCGCTATGCAGCACAGCAGCGGGCCTCTCCGATCAGCCCGGCCACCGTCCAGCGTCTGCCATATCCATTGAAT
CGATTACCCGGTTCGGGGTGGCGGATATGGAATTCCATCAAGGGCCGGGAAGGCACGCGCCCCGCATTTCGAGTG
GGCCAGGTGGACGCTGAATTGTTGGATGAGGAGTTGCTTGGGCTGCTGAAGGGCCAGGTCGGGGATGCTCTCAAA
TACTTCGGGCCTCAAATGCGCGAAGATTGGTCACATGAGATTCTGTTCGCGTTACGGGCCATGCTCTTTAAACTA
TCAATATGGGATCATAACGCATCGTATGGTGCGGCACTACAAGGCCTCAAATACACCGATAGTCGAAGCAAAGGA
CCCGTTTTCTCTTCTCCGACAAAATGGCAGAAGGGTATTTATGGCTTATTGACGGTTGGAGGGCGATATGCTTGG
GACAAGTGGGAGAGCTGGTTGGTCGGACAAGAAGGTGGCTATGACGAGCCATCACCGGACATCCGAATGCTGTCG
CGACTAACAGACATGATCTCGACATCGCACTCGATTGCTGCCTTCGTCTCTTTCCTGGTATTCCTAGTGAATGGC
CGATACCGTACCTTGGTCGATCGCATCCTTCGAATCCGCCTTACTCCACCGTCTGCGCAGGCTAGCCGGGAAGTA
TCCTTTGAGTATTTAAACCGTCAACTAGTTTGGCATGCTTTTACCGAATTCCTTCTTTTCCTCCTTCCTCTTGTT
GGAATTGGCCGCTGGCGGCGATGGATATCCCGGGTCTGGAAAAAGATGGTCAATTCTGTCCGGTCAAGCGGCGAT
GACGACGAGACCCCCGAAAAACAAGGAGAGCTGGCCTTCCTCCCAGAGCGAACCTGTGCTATCTGCTACTACGAT
CAGAACCCCACCACAACGACCGAAAGCGATACCATAGCCGCCTCTGCGTCAGGGGGTATTGTAGGATCGGCGCAA
ACTGATATCACAAACCCATATGAGACCGTCCCTTGCGGCTGTATCTATTGTTTCGTCTGTATTGTGCAGAAACTG
GAAGCGGAAGAAGGCCAGGGATGGTCTTGCCTCCGGTGTGGTGAAATTGTCAAGAAGTGCCAACCTTGGAATGGC
GATGTGCTAGAAGAGGCGCGGTCGCAGCCTGGAACTGGGAAGATTGTTGGCTTTGCCATTGACGGTGAACTGAAT
GGCGAGACCCGTGGGACAGATCTTCATCAAGGGGGCTCATCAAATAAGTCTAGCCCATTGCAAGAGATCAGTGCC
GATGAAGCCCTGCAGCATTCAGAGCAATGGTCCACCATTGAGAAAGAGGCAGAAGATGATGGCAGAAGAGGTACG
AACGAGGATGAGGGCCCAAACCCTGCTGCGATGTGA
Gene >Pro_DTO377G3_2|g4922.t1
ATGAGTTCAACAAACTTCGCCGCTGCACAAGAACGAGTTCTTCAACGTCGTCGCCAGCGTGAGGCGGAAGCGCGC
GCCCGCTATGCAGCACAGCAGCGGGCCTCTCCGATCAGCCCGGCCACCGTCCAGCGTCTGCCATATCCATTGAAT
CGATTACCCGGTTCGGGGTGGCGGATATGGAATTCCATCAAGGGCCGGGAAGGCACGCGCCCCGCATTTCGAGTG
GGCCAGGTGGACGCTGAATTGTTGGATGAGGAGTTGCTTGGGCTGCTGAAGGGCCAGGTCGGGGATGCTCTCAAA
TACTTCGGGGTATGTCTGAATGAGGCTCTGGGGTGTTGTGAGAAAAAGTAGCTGACACCGACAATAGCCTCAAAT
GCGCGAAGATTGGTCACATGAGATTCTGTTCGCGTTACGGGCCATGCTCTTTAAACTATCAATATGGGATCATAA
CGCATCGTATGGTGCGGCACTACAAGGCCTCAAATACACCGATAGTCGAAGCAAAGGACCCGTTTTCTCTTCTCC
GACAAAATGGCAGAAGGGTATTTATGGCTTATTGACGGTTGGAGGGCGATATGCTTGGGACAAGTGGGAGAGCTG
GTTGGTCGGACAAGAAGGTGGCTATGACGAGGTTAGTGCCGACACATTGCTCTCTATTGGCAATGCTTTACTAAC
AGATACTACAAAGCCATCACCGGACATCCGAATGCTGTCGCGACTAACAGACATGATCTCGACATCGCACTCGAT
TGCTGCCTTCGTCTCTTTCCTGGTATTCCTAGTGAATGGCCGATACCGTACCTTGGTCGATCGCATCCTTCGAAT
CCGCCTTACTCCACCGTCTGCGCAGGCTAGCCGGGAAGTATCCTTTGAGTATTTAAACCGTCAACTAGTTTGGCA
TGCTTTTACCGAATTCCTTCTTTTCCTCCTTCCTCTTGTTGGAATTGGCCGCTGGCGGCGATGGATATCCCGGGT
CTGGAAAAAGATGGTCAATTCTGTCCGGTCAAGCGGCGATGACGACGAGACCCCCGAAAAACAAGGAGAGCTGGC
CTTCCTCCCAGAGCGAACCTGTGCTATCTGCTACTACGATCAGAACCCCACCACAACGACCGAAAGCGATACCAT
AGCCGCCTCTGCGTCAGGGGGTATTGTAGGATCGGCGCAAACTGATATCACAAACCCATATGAGACCGTCCCTTG
CGGCTGTATCTATTGTTTCGTCTGTATTGTGCAGAAACTGGAAGCGGAAGAAGGCCAGGGATGGTCTTGCCTCCG
GTGTGGTGAAATTGTCAAGAAGTGCCAACCTTGGAATGGCGATGTGCTAGAAGAGGCGCGGTCGCAGCCTGGAAC
TGGGAAGATTGTTGGCTTTGCCATTGACGGTGAACTGAATGGCGAGACCCGTGGGACAGATCTTCATCAAGGGGG
CTCATCAAATAAGTCTAGCCCATTGCAAGAGATCAGTGCCGATGAAGCCCTGCAGCATTCAGAGCAATGGTCCAC
CATTGAGAAAGAGGCAGAAGATGATGGCAGAAGAGGTACGAACGAGGATGAGGGCCCAAACCCTGCTGCGATGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail