Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4911.t1
Gene name
Locationscaffold_11:38790..40134
Strand-
Gene length (bp)1344
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 6.4E-44 64 409

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 112 134 22
3 149 171 22
4 204 223 19
5 238 260 22
6 281 303 22
7 340 359 19
8 364 386 22
9 391 410 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4911.t1
MGRQKQGAPLKRAPSSQLMHISEESDVGQNSGNNTDTVSTAKGSVSEKASAALETVTDSPGLTQLAICVLGIYAA
FLSWGVLQEAITTTSYLVRPATVAEPNPPTERFTYSLVLNTVQSLFAAITGFAYLLFSTPSGQKIPSIFPTRRII
VPLLLVAISSSLASPFGYASLEHIDYLTFILAKSCKLLPVMVLHLTIFRKRYPLYKYGVVLMVTLGVATFSLHHP
GTSKKVAAKDQSGSSGWGIFLLSINLLLDGLTNTTQDHVFSSPKLYTRFTGPQMMVAQNVLSTVLTSAYLLIMPH
LSQSGILHNLLPFPIPPSNETELFGAFSFLSRHPEALKHVLGFAACGAVGQLFIFHTLSRFSSLLLVTVTVTRKM
LTMLLSVFWFGHSLSRGQWLGISLVFGGIGAEAVVQRSEKKAKEQSKIEAAKKKL*
Coding >Pro_DTO377G3_2|g4911.t1
ATGGGACGACAAAAGCAAGGCGCGCCGCTCAAGAGAGCCCCTTCTTCTCAATTAATGCACATCTCAGAAGAGTCC
GACGTGGGACAGAATTCTGGAAACAATACAGACACAGTCTCGACCGCCAAGGGAAGCGTGTCCGAAAAAGCATCA
GCGGCCCTGGAGACAGTCACCGACAGCCCTGGGCTGACGCAACTTGCGATTTGTGTTCTCGGTATATATGCGGCA
TTCCTCTCGTGGGGTGTGCTACAGGAGGCGATCACGACAACCAGCTATCTCGTTCGTCCTGCAACCGTTGCGGAG
CCAAACCCTCCAACGGAGCGATTCACCTACTCGCTGGTGCTGAACACGGTCCAATCTCTCTTCGCGGCCATCACC
GGCTTTGCATACCTACTATTCTCAACACCGAGTGGCCAAAAAATTCCATCTATCTTCCCTACACGCCGGATCATC
GTCCCCCTGCTTCTAGTTGCAATCTCCTCGTCACTTGCGTCACCCTTCGGCTACGCCAGTCTCGAACACATTGAC
TACCTGACCTTCATCCTCGCCAAGTCATGCAAGCTCCTCCCGGTGATGGTCTTGCACCTGACCATATTCCGCAAG
AGATACCCACTGTACAAATACGGTGTTGTCCTGATGGTCACTCTCGGCGTCGCAACCTTCAGTCTGCACCACCCC
GGAACTAGTAAGAAAGTCGCTGCCAAGGACCAGTCTGGATCCTCCGGCTGGGGCATCTTCTTGTTGTCAATCAAC
CTCCTTTTGGATGGCCTGACCAACACTACGCAAGACCACGTCTTCTCCTCGCCCAAGCTGTACACCCGCTTCACC
GGACCCCAGATGATGGTCGCTCAGAATGTTCTCTCGACCGTTCTGACTTCTGCGTACCTCCTGATCATGCCGCAT
CTCTCACAGAGCGGGATTTTGCACAACCTCCTGCCATTCCCCATTCCCCCGTCTAATGAGACTGAACTGTTTGGT
GCCTTCTCCTTCCTCTCTCGCCACCCAGAGGCACTGAAGCATGTCCTTGGGTTCGCGGCATGCGGGGCTGTTGGC
CAGCTTTTCATCTTCCACACTTTGTCTCGTTTCTCTTCACTGTTGCTTGTCACTGTCACCGTTACACGTAAGATG
TTGACTATGCTCCTCAGCGTTTTCTGGTTCGGACATTCTCTGTCCCGTGGCCAGTGGCTGGGAATTAGTCTGGTC
TTCGGCGGCATTGGCGCCGAAGCAGTGGTACAAAGATCAGAGAAGAAGGCGAAAGAGCAGTCGAAGATTGAGGCT
GCAAAGAAGAAGTTGTGA
Transcript >Pro_DTO377G3_2|g4911.t1
ATGGGACGACAAAAGCAAGGCGCGCCGCTCAAGAGAGCCCCTTCTTCTCAATTAATGCACATCTCAGAAGAGTCC
GACGTGGGACAGAATTCTGGAAACAATACAGACACAGTCTCGACCGCCAAGGGAAGCGTGTCCGAAAAAGCATCA
GCGGCCCTGGAGACAGTCACCGACAGCCCTGGGCTGACGCAACTTGCGATTTGTGTTCTCGGTATATATGCGGCA
TTCCTCTCGTGGGGTGTGCTACAGGAGGCGATCACGACAACCAGCTATCTCGTTCGTCCTGCAACCGTTGCGGAG
CCAAACCCTCCAACGGAGCGATTCACCTACTCGCTGGTGCTGAACACGGTCCAATCTCTCTTCGCGGCCATCACC
GGCTTTGCATACCTACTATTCTCAACACCGAGTGGCCAAAAAATTCCATCTATCTTCCCTACACGCCGGATCATC
GTCCCCCTGCTTCTAGTTGCAATCTCCTCGTCACTTGCGTCACCCTTCGGCTACGCCAGTCTCGAACACATTGAC
TACCTGACCTTCATCCTCGCCAAGTCATGCAAGCTCCTCCCGGTGATGGTCTTGCACCTGACCATATTCCGCAAG
AGATACCCACTGTACAAATACGGTGTTGTCCTGATGGTCACTCTCGGCGTCGCAACCTTCAGTCTGCACCACCCC
GGAACTAGTAAGAAAGTCGCTGCCAAGGACCAGTCTGGATCCTCCGGCTGGGGCATCTTCTTGTTGTCAATCAAC
CTCCTTTTGGATGGCCTGACCAACACTACGCAAGACCACGTCTTCTCCTCGCCCAAGCTGTACACCCGCTTCACC
GGACCCCAGATGATGGTCGCTCAGAATGTTCTCTCGACCGTTCTGACTTCTGCGTACCTCCTGATCATGCCGCAT
CTCTCACAGAGCGGGATTTTGCACAACCTCCTGCCATTCCCCATTCCCCCGTCTAATGAGACTGAACTGTTTGGT
GCCTTCTCCTTCCTCTCTCGCCACCCAGAGGCACTGAAGCATGTCCTTGGGTTCGCGGCATGCGGGGCTGTTGGC
CAGCTTTTCATCTTCCACACTTTGTCTCGTTTCTCTTCACTGTTGCTTGTCACTGTCACCGTTACACGTAAGATG
TTGACTATGCTCCTCAGCGTTTTCTGGTTCGGACATTCTCTGTCCCGTGGCCAGTGGCTGGGAATTAGTCTGGTC
TTCGGCGGCATTGGCGCCGAAGCAGTGGTACAAAGATCAGAGAAGAAGGCGAAAGAGCAGTCGAAGATTGAGGCT
GCAAAGAAGAAGTTGTGA
Gene >Pro_DTO377G3_2|g4911.t1
ATGGGACGACAAAAGCAAGGCGCGCCGCTCAAGAGAGCCCCTTCTTCTCAATTAATGCACATCTCAGAAGAGTCC
GACGTGGGACAGAATTCTGGAAACAATACAGACACAGTCTCGACCGCCAAGGGAAGCGTGTCCGAAAAAGCATCA
GCGGCCCTGGAGACAGTCACCGACAGCCCTGGGCTGACGCAACTTGCGATTTGTGTTCTCGGTATATATGCGGCA
TTGTAAGTGCCTCCACCGCTAGGACTGGCCGGAGAAATTAACAAGACGAAAAGCCTCTCGTGGGGTGTGCTACAG
GAGGCGATCACGACAACCAGCTATCTCGTTCGTCCTGCAACCGTTGCGGAGCCAAACCCTCCAACGGAGCGATTC
ACCTACTCGCTGGTGCTGAACACGGTCCAATCTCTCTTCGCGGCCATCACCGGCTTTGCATACCTACTATTCTCA
ACACCGAGTGGCCAAAAAATTCCATCTATCTTCCCTACACGCCGGATCATCGTCCCCCTGCTTCTAGTTGCAATC
TCCTCGTCACTTGCGTCACCCTTCGGCTACGCCAGTCTCGAACACATTGACTACCTGACCTTCATCCTCGCCAAG
TCATGCAAGCTCCTCCCGGTGATGGTCTTGCACCTGACCATATTCCGCAAGAGATACCCACTGTACAAATACGGT
GTTGTCCTGATGGTCACTCTCGGCGTCGCAACCTTCAGTCTGCACCACCCCGGAACTAGTAAGAAAGTCGCTGCC
AAGGACCAGTCTGGATCCTCCGGCTGGGGCATCTTCTTGTTGTCAATCAACCTCCTTTTGGATGGCCTGACCAAC
ACTACGCAAGACCACGTCTTCTCCTCGCCCAAGCTGTACACCCGCTTCACCGGACCCCAGATGATGGTCGCTCAG
AATGTTCTCTCGACCGTTCTGACTTCTGCGTACCTCCTGATCATGCCGCATCTCTCACAGAGCGGGATTTTGCAC
AACCTCCTGCCATTCCCCATTCCCCCGTCTAATGAGACTGAACTGTTTGGTGCCTTCTCCTTCCTCTCTCGCCAC
CCAGAGGCACTGAAGCATGTCCTTGGGTTCGCGGCATGCGGGGCTGTTGGCCAGCTTTTCATCTTCCACACTTTG
TCTCGTTTCTCTTCACTGTTGCTTGTCACTGTCACCGTTACACGTAAGATGTTGACTATGCTCCTCAGCGTTTTC
TGGTTCGGACATTCTCTGTCCCGTGGCCAGTGGCTGGGAATTAGTCTGGTCTTCGGCGGCATTGGCGCCGAAGCA
GTGGTACAAAGATCAGAGAAGAAGGCGAAAGAGCAGTCGAAGATTGAGGCTGCAAAGAAGAAGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail