Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4899.t1
Gene name
Locationscaffold_11:9882..11219
Strand+
Gene length (bp)1337
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase 2.0E-81 13 359

GO

GO Term Description Terminal node
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4899.t1
MLDQVNQYSPTPLWLDCDPGHDDAFAILIAAHHPYLKLLGISTVHGNASLEKTTANAGSVLEAIGKPDIPVYPGS
NKPFSRPALHAPDIHGESGLDGTDLLPKATRAPITDKNAIVAMRDALLAQPKGTPWLVATGTLTNAALLFATFPE
VAEHIQGLSIMGGAIGGGFTDAPMSRLPGEKARIGNVTPWAEFNFYCDPESAESIFSNPVLASKTAIMALDLTHQ
VLATQAVQTRILYGSIHSAEDPTILRQILHALLTFFAATYEKTFGLTTGPPLHDPLAVAAILSTLNPAFANVHPN
QTLAFDDKGGERFALSIVTDGKHGKDVSITGQLGRSIATPVDGPGVAIPRGVDLDAFWNMVLQCVQLADDCNAAR
VA*
Coding >Pro_DTO377G3_2|g4899.t1
ATGTTAGACCAAGTTAATCAATATAGTCCTACTCCCTTGTGGTTAGATTGCGATCCTGGCCACGATGATGCTTTT
GCAATTTTGATCGCCGCTCATCACCCATATTTGAAGCTTCTTGGAATCAGTACTGTCCATGGAAATGCATCATTA
GAGAAGACAACCGCCAATGCCGGCAGCGTCTTGGAAGCGATCGGAAAGCCTGACATTCCCGTCTATCCTGGTAGC
AATAAGCCATTTTCACGGCCTGCTCTTCATGCACCTGATATTCACGGCGAGTCCGGTCTTGATGGGACTGACCTT
CTTCCCAAGGCCACTAGAGCACCCATCACCGATAAGAACGCCATTGTGGCCATGAGAGATGCTCTTCTTGCACAA
CCCAAAGGAACTCCTTGGCTGGTTGCAACGGGTACATTGACCAACGCCGCACTGTTGTTTGCCACATTCCCCGAG
GTAGCTGAACACATCCAAGGGCTGAGCATTATGGGTGGTGCCATTGGTGGAGGATTCACCGATGCCCCCATGAGT
AGACTACCTGGTGAGAAGGCTAGGATCGGAAATGTGACCCCATGGGCTGAGTTCAACTTCTATTGTGACCCAGAG
TCTGCTGAGTCAATCTTTAGCAACCCAGTTCTTGCTTCTAAGACAGCTATTATGGCTTTAGATCTCACACATCAG
GTCTTGGCCACACAGGCTGTTCAAACGCGCATCTTGTATGGCTCGATCCACTCGGCCGAGGATCCTACTATCCTT
CGGCAGATATTGCACGCGCTACTCACTTTCTTTGCTGCCACATACGAGAAAACCTTTGGTTTGACCACCGGGCCT
CCATTGCATGATCCCCTTGCTGTGGCCGCGATCCTGTCGACGCTGAACCCAGCCTTTGCCAACGTGCACCCCAAT
CAAACTCTCGCTTTTGATGACAAAGGCGGCGAGCGTTTTGCTTTGAGTATTGTCACCGATGGAAAGCACGGGAAA
GATGTATCTATTACAGGTCAACTGGGGCGCTCGATCGCTACTCCTGTTGATGGTCCGGGTGTTGCTATTCCCAGG
GGTGTTGATCTAGATGCTTTCTGGAACATGGTCCTACAATGTGTCCAGCTGGCCGATGATTGCAATGCTGCACGC
GTGGCCTGA
Transcript >Pro_DTO377G3_2|g4899.t1
ATGTTAGACCAAGTTAATCAATATAGTCCTACTCCCTTGTGGTTAGATTGCGATCCTGGCCACGATGATGCTTTT
GCAATTTTGATCGCCGCTCATCACCCATATTTGAAGCTTCTTGGAATCAGTACTGTCCATGGAAATGCATCATTA
GAGAAGACAACCGCCAATGCCGGCAGCGTCTTGGAAGCGATCGGAAAGCCTGACATTCCCGTCTATCCTGGTAGC
AATAAGCCATTTTCACGGCCTGCTCTTCATGCACCTGATATTCACGGCGAGTCCGGTCTTGATGGGACTGACCTT
CTTCCCAAGGCCACTAGAGCACCCATCACCGATAAGAACGCCATTGTGGCCATGAGAGATGCTCTTCTTGCACAA
CCCAAAGGAACTCCTTGGCTGGTTGCAACGGGTACATTGACCAACGCCGCACTGTTGTTTGCCACATTCCCCGAG
GTAGCTGAACACATCCAAGGGCTGAGCATTATGGGTGGTGCCATTGGTGGAGGATTCACCGATGCCCCCATGAGT
AGACTACCTGGTGAGAAGGCTAGGATCGGAAATGTGACCCCATGGGCTGAGTTCAACTTCTATTGTGACCCAGAG
TCTGCTGAGTCAATCTTTAGCAACCCAGTTCTTGCTTCTAAGACAGCTATTATGGCTTTAGATCTCACACATCAG
GTCTTGGCCACACAGGCTGTTCAAACGCGCATCTTGTATGGCTCGATCCACTCGGCCGAGGATCCTACTATCCTT
CGGCAGATATTGCACGCGCTACTCACTTTCTTTGCTGCCACATACGAGAAAACCTTTGGTTTGACCACCGGGCCT
CCATTGCATGATCCCCTTGCTGTGGCCGCGATCCTGTCGACGCTGAACCCAGCCTTTGCCAACGTGCACCCCAAT
CAAACTCTCGCTTTTGATGACAAAGGCGGCGAGCGTTTTGCTTTGAGTATTGTCACCGATGGAAAGCACGGGAAA
GATGTATCTATTACAGGTCAACTGGGGCGCTCGATCGCTACTCCTGTTGATGGTCCGGGTGTTGCTATTCCCAGG
GGTGTTGATCTAGATGCTTTCTGGAACATGGTCCTACAATGTGTCCAGCTGGCCGATGATTGCAATGCTGCACGC
GTGGCCTGA
Gene >Pro_DTO377G3_2|g4899.t1
ATGTTAGACCAAGTTAATCAATATAGTCCTACTCCCTTGTGGTTAGATTGCGATCCTGGTCAGTCTATCATGTTC
CTTCCGCCTTCTTATTACTGACTGTTCTTAGGCCACGATGTAAGCATCAAAGAAATTCTAGAGAGACATTTGTTA
ATACGATACAGGATGCTTTTGCAATTTTGATCGCCGCTCATCACCCATATTTGAAGCTTCTTGGAATCAGTACTG
TCCATGGAAATGCATCATTAGAGAAGACAACCGCCAATGCCGGCAGCGTCTTGGAAGCGATCGGAAAGCCTGACA
TTCCCGTCTATCCTGGTAGCAATAAGCCATTTTCACGGCCTGCTCTTCATGCACCTGATATTCACGGTAAGTTGA
TGCTGATATCAGGAGCAGAATGTTTTAATAACACTTTCCAGGCGAGTCCGGTCTTGATGGGACTGACCTTCTTCC
CAAGGCCACTAGAGCACCCATCACCGATAAGAACGCCATTGTGGCCATGAGAGATGCTCTTCTTGCACAACCCAA
AGGAACTCCTTGGCTGGTTGCAACGGGTACATTGACCAACGCCGCACTGTTGTTTGCCACATTCCCCGAGGTAGC
TGAACACATCCAAGGGCTGAGCATTATGGGTGGTGCCATTGGTGGAGGATTCACCGATGCCCCCATGAGTAGACT
ACCTGGTGAGAAGGCTAGGATCGGAAATGTGACCCCATGGGCTGAGTTCAACTTCTATGTACGTTCGCAAAACCT
TTCATCCTTCTCTGGCTCGTCTAATCACGATGGTATTATAGTGTGACCCAGAGTCTGCTGAGTCAATCTTTAGCA
ACCCAGTTCTTGCTTCTAAGACAGCTATTATGGCTTTAGATCTCACACATCAGGTCTTGGCCACACAGGCTGTTC
AAACGCGCATCTTGTATGGCTCGATCCACTCGGCCGAGGATCCTACTATCCTTCGGCAGATATTGCACGCGCTAC
TCACTTTCTTTGCTGCCACATACGAGAAAACCTTTGGTTTGACCACCGGGCCTCCATTGCATGATCCCCTTGCTG
TGGCCGCGATCCTGTCGACGCTGAACCCAGCCTTTGCCAACGTGCACCCCAATCAAACTCTCGCTTTTGATGACA
AAGGCGGCGAGCGTTTTGCTTTGAGTATTGTCACCGATGGAAAGCACGGGAAAGATGTATCTATTACAGGTCAAC
TGGGGCGCTCGATCGCTACTCCTGTTGATGGTCCGGGTGTTGCTATTCCCAGGGGTGTTGATCTAGATGCTTTCT
GGAACATGGTCCTACAATGTGTCCAGCTGGCCGATGATTGCAATGCTGCACGCGTGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail