Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4889.t1
Gene name
Locationscaffold_10:677755..684824
Strand-
Gene length (bp)7069
Transcript length (bp)5244
Coding sequence length (bp)5244
Protein length (aa) 1748

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19) 2.0E-108 85 414
PF01490 Aa_trans Transmembrane amino acid transporter protein 2.4E-17 1273 1652
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.7E-04 473 506

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0016805 dipeptidase activity Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0006508 proteolysis Yes
GO:0080090 regulation of primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0140110 transcription regulator activity No
GO:0046872 metal ion binding No
GO:0003700 DNA-binding transcription factor activity No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043226 organelle No
GO:0050794 regulation of cellular process No
GO:0044464 cell part No
GO:0140096 catalytic activity, acting on a protein No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0065007 biological regulation No
GO:0043227 membrane-bounded organelle No
GO:0050789 regulation of biological process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0043169 cation binding No
GO:0019538 protein metabolic process No
GO:0005488 binding No
GO:0019222 regulation of metabolic process No
GO:0044424 intracellular part No
GO:0008233 peptidase activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0008150 biological_process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008238 exopeptidase activity No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 1013 1035 22
2 1273 1295 22
3 1305 1327 22
4 1354 1376 22
5 1381 1403 22
6 1410 1432 22
7 1480 1502 22
8 1515 1537 22
9 1557 1579 22
10 1600 1622 22
11 1632 1651 19
12 1701 1723 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4889.t1
MNRLDAIEPQWPTGSSLCEGTTSDNENHSRVIVFNAQRGKSWNPLKLVAIGSISIALWVAIRARDLVQPQDIDPL
NFAARTTRVLSEIPLIDGHNDLPFLVRLQLNNQIYGDNLPFDQGLASHTDLKRMKQGKVGGQFWSVFVECPRILH
LDDPNHSVRDTLEQIDVAKRLIAEYSELQYCDTAACARQAFKSKRISSMLGAEGLHQIGSSLAVIRQMYELGVRY
ITLTHNCDNAFATAASTVTETGKDNGLSDFGRAAIREMNRLGMMIDLSHTSHRTMRDAIAATRAPVIFSHSACYA
LAKRLRNTPDDVLRMLRQNGGLIMIFFANKFIRPDNPDKASLEDVVDHIFHAASIAGWDHVGIGSDFDGTPAVAS
GIEDVSAYPRLIEAVMRRGATDEQVRKLVGLNILRVWGQNEIVSAQIQKNKNIDSADKGNAPASRPPPPSSSLPR
VRVVNMSGRSKSTRAQRPPRVASCEPCRLSKLACDHRQPCARCVGRDIPHECVYRKNAFKRSRPSFTPQSPGMQH
QLAFNSTSILEAIQPTLPPNTHPNTGYQGSSSLDSLLGNVREQTMLFGDLEAASTLLPVGRDDEGPAYSTRFMNN
ASTVEGAQLLETLTSSKINNTVMHFFSDWKGNGLESHVGAILIQPFADAVIEEIVTLQHSKNFRSDLLALSQRLF
ENSSRPVEIHRLMTLQGLIDQYTGPNLRWETMGAILTLVGIAATEFRAPYALYRTEPERQTLRMNLIQFGNKCAI
FCEALEVLNDVHILFLYQTFQVQSVFYGDQSLKTWRRLNDAACALLAAGLHESIQEARDVPFFLVELRKRIFSRL
YSIDISLATFLGRPPRMSKKFCCINLPLDIDEKCYSLSETALSRELEDIDHAGWNSQGHIRPSAVMRWSTITAMI
REETLELLLGRNIYDMQRRIIDLHHELNKAWENLPSFLRVPSHELWDIQRPRMEMECLHMTRILYLQSSFLIEWA
AWRHGLEHSSLFRSAMELISSVNDALVRREQLPNLGFISLAWRVASCALPAAGALALYLLQPSSRCRFKELDPPS
RRRVIENLSVLIVHMDILHSPSDGNFKLFSQAKRSLQSVVDMLLQPVNPLGMETSPTQLNAEMPTADWMVPDYCA
FDGDFWANFPDCLYTEENSDTALPILHSLSMNMELSLDEKEGGFMPESPRELTSPGELTSTTLIKPQARDAYDPN
ITFEEYHYYSKKTREEEELLEPPVLNIRQLLSGKKTEEGPITTLTEKDFSTRERRLAITDEEWTNASRSLRSASW
GACFYLITTDILGPYGAGFAMGTLGWGPGIAFYTVFGFMAGYSGYLLWRVFLGVDSYEFPAKNYGDLGFRTLGRY
GRHLTNVSQAISLLLLVGQVTIGFGENISQVSQFRLCYVVCPVIFACVGFFVSQIRTLKAYGWIANLAVWMNLFV
IFMTMGVMSMSPPNYKISTLGSAGSAVDRATITPDSEGNYPPIMHYNNIPTDGLIGSVNGMLSGVLAYAGAQLFV
EFMAEMRRPRDFLKAMWGAQFFIYSVYLTHGCVVYHLQGQYSFSPSYQGISVYSWQTVGNMVSLLSALICAGLYG
NIGVKIVYNNVLMDIFGMPPLNTRVGKIVYASLVPIWWTIAFIIAAAVPDYFGFVSIISASMLLNLTFTIPPLFA
LAFDIQKNAIRPEIGEGFNPTTGEVIRTESTTARWVRGFFSGGTFQVATNVWHIVFCLASLSMCGLGMWAAIVGM
VDAFQLPQLNSFSCVSPLNLNA*
Coding >Pro_DTO377G3_2|g4889.t1
ATGAATCGCTTGGATGCAATTGAGCCACAATGGCCAACGGGGTCATCATTGTGCGAGGGTACCACGAGTGATAAT
GAGAATCATAGTCGGGTAATTGTGTTCAACGCACAAAGAGGGAAATCATGGAATCCTCTCAAGCTTGTTGCGATT
GGTTCCATCTCTATAGCGCTCTGGGTTGCGATAAGAGCAAGAGACCTAGTGCAGCCTCAAGATATCGATCCATTG
AACTTTGCGGCTCGAACGACCAGGGTATTATCGGAAATACCTCTCATAGATGGACATAACGATCTTCCATTCCTT
GTCCGACTGCAGCTCAACAATCAGATTTATGGAGACAACCTTCCATTTGATCAGGGACTTGCATCTCATACAGAT
CTTAAGCGGATGAAGCAGGGCAAAGTGGGTGGGCAGTTTTGGTCGGTCTTTGTAGAGTGTCCCCGAATACTTCAT
CTTGACGATCCAAATCATAGTGTTCGTGATACCCTTGAGCAGATTGATGTGGCAAAGCGCTTGATAGCGGAATAT
AGCGAGCTGCAGTATTGCGACACAGCAGCATGTGCTCGACAAGCCTTCAAATCAAAGAGAATATCTTCCATGCTC
GGTGCTGAAGGACTCCATCAGATCGGTTCATCCCTTGCCGTGATCCGGCAAATGTACGAGCTCGGGGTGCGCTAT
ATCACTCTAACCCACAACTGTGACAATGCATTCGCTACTGCGGCCAGCACAGTAACGGAAACAGGCAAGGATAAT
GGACTGAGTGACTTTGGACGTGCCGCGATACGCGAAATGAATCGCCTAGGGATGATGATAGACCTCTCCCACACG
TCTCACCGAACAATGCGAGATGCTATAGCTGCGACTCGGGCACCAGTGATATTTTCCCATTCGGCGTGTTATGCG
CTCGCAAAGCGTCTGAGAAATACCCCCGATGACGTCCTTCGGATGCTCCGCCAAAATGGTGGCCTAATCATGATC
TTTTTTGCGAACAAGTTCATTCGACCTGACAACCCGGACAAGGCCAGTTTGGAAGACGTGGTCGATCACATATTC
CATGCTGCCTCCATCGCCGGCTGGGACCATGTTGGAATTGGCAGCGATTTTGATGGGACACCTGCTGTTGCCAGT
GGGATCGAGGATGTCTCGGCATACCCGAGACTCATTGAAGCTGTCATGCGACGCGGTGCAACCGACGAGCAGGTG
CGAAAACTAGTGGGATTAAATATTCTGCGCGTTTGGGGGCAAAATGAGATTGTGTCGGCTCAAATACAGAAAAAC
AAAAACATCGACTCAGCTGATAAGGGGAACGCCCCCGCTTCTCGTCCGCCGCCCCCATCTTCCAGTCTTCCACGT
GTGCGTGTGGTGAATATGTCTGGTCGTTCAAAGAGTACGCGGGCACAGCGGCCACCGAGAGTCGCATCCTGTGAA
CCCTGTCGACTCTCTAAACTAGCCTGCGATCATCGCCAACCTTGCGCTCGGTGTGTCGGGCGAGATATCCCCCAT
GAGTGCGTCTACAGGAAGAATGCGTTCAAGCGGAGTCGACCCTCCTTTACACCCCAATCTCCGGGAATGCAACAT
CAGCTGGCTTTTAATTCTACATCCATCCTAGAAGCCATCCAGCCAACTCTGCCACCAAATACACACCCTAATACG
GGGTATCAAGGCTCTTCTTCTCTAGACTCACTGTTAGGCAATGTACGCGAGCAAACCATGTTGTTTGGGGATCTG
GAAGCTGCCTCGACCTTGCTTCCGGTCGGGCGGGATGATGAGGGGCCAGCTTACTCTACTCGTTTCATGAACAAC
GCTTCGACCGTCGAGGGCGCACAGCTGCTAGAAACACTGACCAGCTCCAAGATAAATAACACCGTTATGCACTTT
TTCTCGGACTGGAAGGGGAACGGGCTCGAGTCGCATGTCGGCGCGATCCTCATTCAGCCATTCGCCGATGCAGTC
ATTGAGGAAATTGTCACCCTACAGCATTCTAAAAATTTCCGATCCGATTTATTAGCTTTGTCACAGCGTTTGTTT
GAAAATAGCAGCCGCCCTGTGGAAATACATCGTTTGATGACGCTGCAAGGCCTCATCGACCAGTATACGGGTCCG
AATCTCCGCTGGGAGACAATGGGAGCAATCCTTACACTTGTTGGTATTGCCGCAACTGAGTTTCGTGCACCATAT
GCTCTGTACCGGACAGAACCAGAACGGCAGACCTTAAGAATGAACCTCATTCAATTTGGAAATAAATGCGCAATC
TTTTGCGAGGCATTGGAGGTTCTCAATGACGTTCATATTCTCTTTCTGTATCAGACGTTCCAGGTGCAGTCTGTT
TTTTATGGTGATCAAAGTCTTAAAACGTGGCGCCGGCTCAACGACGCAGCCTGTGCTCTACTTGCCGCTGGACTC
CACGAGAGCATCCAAGAAGCGCGCGATGTTCCCTTCTTTCTGGTTGAACTAAGAAAACGTATTTTTTCCCGCTTA
TACAGTATCGATATCAGCCTAGCAACATTTCTCGGGCGACCACCGCGCATGAGCAAGAAATTTTGCTGTATCAAC
TTGCCCCTTGATATTGACGAGAAGTGTTATTCCCTGTCGGAGACTGCTCTCAGTAGAGAGCTGGAAGATATTGAT
CACGCCGGCTGGAATTCGCAGGGTCACATCCGACCGAGTGCTGTTATGCGATGGTCAACGATTACAGCAATGATT
CGAGAAGAGACGTTGGAATTGCTTCTGGGCAGGAATATATATGATATGCAACGGCGAATAATTGACTTGCACCAT
GAACTCAACAAGGCATGGGAGAACCTACCGTCCTTTCTGAGGGTGCCATCTCACGAACTCTGGGATATCCAAAGA
CCGCGCATGGAAATGGAGTGCTTACATATGACTCGGATTTTATATCTACAGTCTTCATTTTTGATCGAATGGGCA
GCATGGCGGCATGGACTCGAACACTCAAGTTTATTTCGCTCCGCAATGGAACTAATTTCCTCGGTTAATGATGCC
TTGGTCCGACGGGAACAGCTACCGAACCTTGGCTTTATATCTCTAGCCTGGAGAGTGGCATCCTGCGCTCTCCCT
GCCGCCGGGGCCCTTGCACTATATCTTCTACAGCCATCATCTCGATGTCGGTTCAAGGAATTAGACCCGCCGTCT
CGACGACGGGTAATCGAGAATCTGTCTGTTCTGATTGTACACATGGATATTTTGCATAGCCCCAGTGACGGTAAT
TTCAAATTGTTTTCCCAGGCCAAGCGCTCTCTCCAGTCTGTTGTGGATATGCTATTACAACCGGTAAATCCACTT
GGAATGGAAACATCACCTACACAGCTCAATGCCGAGATGCCCACCGCTGACTGGATGGTGCCTGACTATTGTGCA
TTCGATGGTGATTTCTGGGCGAATTTCCCCGATTGCCTCTATACAGAGGAGAATAGCGATACTGCACTTCCTATT
CTACACTCACTGTCGATGAATATGGAACTCTCTTTGGACGAGAAAGAGGGCGGTTTCATGCCAGAATCGCCTCGG
GAGTTGACTTCGCCTGGAGAGTTGACTTCAACAACCCTCATCAAACCACAGGCTCGCGACGCTTACGATCCAAAT
ATCACATTCGAGGAGTACCATTACTATTCGAAGAAGACAAGAGAAGAGGAAGAGCTTTTGGAGCCTCCGGTGCTC
AATATCCGACAGCTTCTCTCAGGCAAAAAGACCGAAGAAGGGCCAATTACAACACTGACAGAGAAAGACTTTTCA
ACTCGCGAGCGGAGACTTGCAATCACAGACGAGGAATGGACAAATGCAAGCCGTTCGCTTAGGTCTGCCTCATGG
GGTGCCTGTTTCTATTTGATCACAACGGATATTCTCGGCCCGTATGGCGCGGGCTTTGCAATGGGCACGTTGGGT
TGGGGACCAGGCATTGCCTTCTACACCGTTTTCGGATTCATGGCCGGATACTCTGGATATCTCCTTTGGCGTGTC
TTCCTCGGCGTGGACAGCTACGAGTTCCCGGCCAAGAACTATGGTGATCTCGGATTCCGGACGCTTGGTCGGTAC
GGTCGCCATCTTACAAATGTCTCTCAGGCGATCTCGCTACTCTTGCTTGTGGGCCAAGTCACGATCGGATTTGGC
GAAAACATCTCTCAAGTATCACAGTTCCGACTCTGCTATGTTGTCTGTCCCGTCATCTTTGCTTGTGTCGGCTTC
TTTGTTTCTCAGATCAGGACTCTCAAAGCGTATGGCTGGATTGCAAATCTCGCAGTGTGGATGAATTTGTTTGTC
ATCTTCATGACTATGGGTGTGATGTCGATGTCTCCACCGAACTACAAAATTTCCACGCTCGGGTCAGCTGGCAGT
GCGGTTGACAGAGCAACGATCACACCGGATAGTGAGGGTAACTACCCGCCGATCATGCATTACAACAATATCCCC
ACGGATGGACTCATTGGGTCGGTGAATGGCATGCTTTCCGGTGTGCTGGCATATGCAGGTGCACAGCTGTTTGTC
GAATTCATGGCCGAAATGCGGCGGCCTCGAGACTTCCTCAAAGCTATGTGGGGAGCCCAGTTTTTCATCTACAGC
GTCTATCTCACTCACGGATGCGTCGTCTATCATCTCCAAGGACAGTACAGCTTCAGTCCGAGTTACCAGGGTATC
AGCGTCTACTCGTGGCAAACCGTCGGCAACATGGTTTCTTTGCTCTCTGCTCTGATCTGCGCAGGCCTCTACGGA
AATATTGGAGTCAAGATCGTCTACAATAACGTCTTGATGGATATTTTCGGTATGCCTCCTCTGAATACCCGGGTT
GGCAAAATTGTCTATGCTTCTCTCGTCCCAATTTGGTGGACGATCGCCTTTATCATTGCCGCAGCCGTTCCAGAT
TACTTTGGCTTCGTCAGCATCATTTCCGCTTCCATGCTTTTGAACTTGACATTTACCATACCTCCCTTGTTTGCC
CTTGCATTTGACATCCAGAAGAATGCTATTCGACCGGAGATTGGTGAAGGATTCAACCCGACAACCGGAGAGGTG
ATCCGGACCGAATCAACAACGGCAAGATGGGTCCGCGGTTTCTTTTCTGGCGGCACCTTCCAAGTCGCCACCAAC
GTTTGGCATATTGTGTTCTGCTTAGCATCACTCTCGATGTGTGGACTGGGCATGTGGGCGGCTATTGTTGGAATG
GTTGATGCCTTCCAGCTCCCGCAGCTTAACTCGTTCTCTTGTGTCTCGCCGCTCAACCTGAATGCTTAA
Transcript >Pro_DTO377G3_2|g4889.t1
ATGAATCGCTTGGATGCAATTGAGCCACAATGGCCAACGGGGTCATCATTGTGCGAGGGTACCACGAGTGATAAT
GAGAATCATAGTCGGGTAATTGTGTTCAACGCACAAAGAGGGAAATCATGGAATCCTCTCAAGCTTGTTGCGATT
GGTTCCATCTCTATAGCGCTCTGGGTTGCGATAAGAGCAAGAGACCTAGTGCAGCCTCAAGATATCGATCCATTG
AACTTTGCGGCTCGAACGACCAGGGTATTATCGGAAATACCTCTCATAGATGGACATAACGATCTTCCATTCCTT
GTCCGACTGCAGCTCAACAATCAGATTTATGGAGACAACCTTCCATTTGATCAGGGACTTGCATCTCATACAGAT
CTTAAGCGGATGAAGCAGGGCAAAGTGGGTGGGCAGTTTTGGTCGGTCTTTGTAGAGTGTCCCCGAATACTTCAT
CTTGACGATCCAAATCATAGTGTTCGTGATACCCTTGAGCAGATTGATGTGGCAAAGCGCTTGATAGCGGAATAT
AGCGAGCTGCAGTATTGCGACACAGCAGCATGTGCTCGACAAGCCTTCAAATCAAAGAGAATATCTTCCATGCTC
GGTGCTGAAGGACTCCATCAGATCGGTTCATCCCTTGCCGTGATCCGGCAAATGTACGAGCTCGGGGTGCGCTAT
ATCACTCTAACCCACAACTGTGACAATGCATTCGCTACTGCGGCCAGCACAGTAACGGAAACAGGCAAGGATAAT
GGACTGAGTGACTTTGGACGTGCCGCGATACGCGAAATGAATCGCCTAGGGATGATGATAGACCTCTCCCACACG
TCTCACCGAACAATGCGAGATGCTATAGCTGCGACTCGGGCACCAGTGATATTTTCCCATTCGGCGTGTTATGCG
CTCGCAAAGCGTCTGAGAAATACCCCCGATGACGTCCTTCGGATGCTCCGCCAAAATGGTGGCCTAATCATGATC
TTTTTTGCGAACAAGTTCATTCGACCTGACAACCCGGACAAGGCCAGTTTGGAAGACGTGGTCGATCACATATTC
CATGCTGCCTCCATCGCCGGCTGGGACCATGTTGGAATTGGCAGCGATTTTGATGGGACACCTGCTGTTGCCAGT
GGGATCGAGGATGTCTCGGCATACCCGAGACTCATTGAAGCTGTCATGCGACGCGGTGCAACCGACGAGCAGGTG
CGAAAACTAGTGGGATTAAATATTCTGCGCGTTTGGGGGCAAAATGAGATTGTGTCGGCTCAAATACAGAAAAAC
AAAAACATCGACTCAGCTGATAAGGGGAACGCCCCCGCTTCTCGTCCGCCGCCCCCATCTTCCAGTCTTCCACGT
GTGCGTGTGGTGAATATGTCTGGTCGTTCAAAGAGTACGCGGGCACAGCGGCCACCGAGAGTCGCATCCTGTGAA
CCCTGTCGACTCTCTAAACTAGCCTGCGATCATCGCCAACCTTGCGCTCGGTGTGTCGGGCGAGATATCCCCCAT
GAGTGCGTCTACAGGAAGAATGCGTTCAAGCGGAGTCGACCCTCCTTTACACCCCAATCTCCGGGAATGCAACAT
CAGCTGGCTTTTAATTCTACATCCATCCTAGAAGCCATCCAGCCAACTCTGCCACCAAATACACACCCTAATACG
GGGTATCAAGGCTCTTCTTCTCTAGACTCACTGTTAGGCAATGTACGCGAGCAAACCATGTTGTTTGGGGATCTG
GAAGCTGCCTCGACCTTGCTTCCGGTCGGGCGGGATGATGAGGGGCCAGCTTACTCTACTCGTTTCATGAACAAC
GCTTCGACCGTCGAGGGCGCACAGCTGCTAGAAACACTGACCAGCTCCAAGATAAATAACACCGTTATGCACTTT
TTCTCGGACTGGAAGGGGAACGGGCTCGAGTCGCATGTCGGCGCGATCCTCATTCAGCCATTCGCCGATGCAGTC
ATTGAGGAAATTGTCACCCTACAGCATTCTAAAAATTTCCGATCCGATTTATTAGCTTTGTCACAGCGTTTGTTT
GAAAATAGCAGCCGCCCTGTGGAAATACATCGTTTGATGACGCTGCAAGGCCTCATCGACCAGTATACGGGTCCG
AATCTCCGCTGGGAGACAATGGGAGCAATCCTTACACTTGTTGGTATTGCCGCAACTGAGTTTCGTGCACCATAT
GCTCTGTACCGGACAGAACCAGAACGGCAGACCTTAAGAATGAACCTCATTCAATTTGGAAATAAATGCGCAATC
TTTTGCGAGGCATTGGAGGTTCTCAATGACGTTCATATTCTCTTTCTGTATCAGACGTTCCAGGTGCAGTCTGTT
TTTTATGGTGATCAAAGTCTTAAAACGTGGCGCCGGCTCAACGACGCAGCCTGTGCTCTACTTGCCGCTGGACTC
CACGAGAGCATCCAAGAAGCGCGCGATGTTCCCTTCTTTCTGGTTGAACTAAGAAAACGTATTTTTTCCCGCTTA
TACAGTATCGATATCAGCCTAGCAACATTTCTCGGGCGACCACCGCGCATGAGCAAGAAATTTTGCTGTATCAAC
TTGCCCCTTGATATTGACGAGAAGTGTTATTCCCTGTCGGAGACTGCTCTCAGTAGAGAGCTGGAAGATATTGAT
CACGCCGGCTGGAATTCGCAGGGTCACATCCGACCGAGTGCTGTTATGCGATGGTCAACGATTACAGCAATGATT
CGAGAAGAGACGTTGGAATTGCTTCTGGGCAGGAATATATATGATATGCAACGGCGAATAATTGACTTGCACCAT
GAACTCAACAAGGCATGGGAGAACCTACCGTCCTTTCTGAGGGTGCCATCTCACGAACTCTGGGATATCCAAAGA
CCGCGCATGGAAATGGAGTGCTTACATATGACTCGGATTTTATATCTACAGTCTTCATTTTTGATCGAATGGGCA
GCATGGCGGCATGGACTCGAACACTCAAGTTTATTTCGCTCCGCAATGGAACTAATTTCCTCGGTTAATGATGCC
TTGGTCCGACGGGAACAGCTACCGAACCTTGGCTTTATATCTCTAGCCTGGAGAGTGGCATCCTGCGCTCTCCCT
GCCGCCGGGGCCCTTGCACTATATCTTCTACAGCCATCATCTCGATGTCGGTTCAAGGAATTAGACCCGCCGTCT
CGACGACGGGTAATCGAGAATCTGTCTGTTCTGATTGTACACATGGATATTTTGCATAGCCCCAGTGACGGTAAT
TTCAAATTGTTTTCCCAGGCCAAGCGCTCTCTCCAGTCTGTTGTGGATATGCTATTACAACCGGTAAATCCACTT
GGAATGGAAACATCACCTACACAGCTCAATGCCGAGATGCCCACCGCTGACTGGATGGTGCCTGACTATTGTGCA
TTCGATGGTGATTTCTGGGCGAATTTCCCCGATTGCCTCTATACAGAGGAGAATAGCGATACTGCACTTCCTATT
CTACACTCACTGTCGATGAATATGGAACTCTCTTTGGACGAGAAAGAGGGCGGTTTCATGCCAGAATCGCCTCGG
GAGTTGACTTCGCCTGGAGAGTTGACTTCAACAACCCTCATCAAACCACAGGCTCGCGACGCTTACGATCCAAAT
ATCACATTCGAGGAGTACCATTACTATTCGAAGAAGACAAGAGAAGAGGAAGAGCTTTTGGAGCCTCCGGTGCTC
AATATCCGACAGCTTCTCTCAGGCAAAAAGACCGAAGAAGGGCCAATTACAACACTGACAGAGAAAGACTTTTCA
ACTCGCGAGCGGAGACTTGCAATCACAGACGAGGAATGGACAAATGCAAGCCGTTCGCTTAGGTCTGCCTCATGG
GGTGCCTGTTTCTATTTGATCACAACGGATATTCTCGGCCCGTATGGCGCGGGCTTTGCAATGGGCACGTTGGGT
TGGGGACCAGGCATTGCCTTCTACACCGTTTTCGGATTCATGGCCGGATACTCTGGATATCTCCTTTGGCGTGTC
TTCCTCGGCGTGGACAGCTACGAGTTCCCGGCCAAGAACTATGGTGATCTCGGATTCCGGACGCTTGGTCGGTAC
GGTCGCCATCTTACAAATGTCTCTCAGGCGATCTCGCTACTCTTGCTTGTGGGCCAAGTCACGATCGGATTTGGC
GAAAACATCTCTCAAGTATCACAGTTCCGACTCTGCTATGTTGTCTGTCCCGTCATCTTTGCTTGTGTCGGCTTC
TTTGTTTCTCAGATCAGGACTCTCAAAGCGTATGGCTGGATTGCAAATCTCGCAGTGTGGATGAATTTGTTTGTC
ATCTTCATGACTATGGGTGTGATGTCGATGTCTCCACCGAACTACAAAATTTCCACGCTCGGGTCAGCTGGCAGT
GCGGTTGACAGAGCAACGATCACACCGGATAGTGAGGGTAACTACCCGCCGATCATGCATTACAACAATATCCCC
ACGGATGGACTCATTGGGTCGGTGAATGGCATGCTTTCCGGTGTGCTGGCATATGCAGGTGCACAGCTGTTTGTC
GAATTCATGGCCGAAATGCGGCGGCCTCGAGACTTCCTCAAAGCTATGTGGGGAGCCCAGTTTTTCATCTACAGC
GTCTATCTCACTCACGGATGCGTCGTCTATCATCTCCAAGGACAGTACAGCTTCAGTCCGAGTTACCAGGGTATC
AGCGTCTACTCGTGGCAAACCGTCGGCAACATGGTTTCTTTGCTCTCTGCTCTGATCTGCGCAGGCCTCTACGGA
AATATTGGAGTCAAGATCGTCTACAATAACGTCTTGATGGATATTTTCGGTATGCCTCCTCTGAATACCCGGGTT
GGCAAAATTGTCTATGCTTCTCTCGTCCCAATTTGGTGGACGATCGCCTTTATCATTGCCGCAGCCGTTCCAGAT
TACTTTGGCTTCGTCAGCATCATTTCCGCTTCCATGCTTTTGAACTTGACATTTACCATACCTCCCTTGTTTGCC
CTTGCATTTGACATCCAGAAGAATGCTATTCGACCGGAGATTGGTGAAGGATTCAACCCGACAACCGGAGAGGTG
ATCCGGACCGAATCAACAACGGCAAGATGGGTCCGCGGTTTCTTTTCTGGCGGCACCTTCCAAGTCGCCACCAAC
GTTTGGCATATTGTGTTCTGCTTAGCATCACTCTCGATGTGTGGACTGGGCATGTGGGCGGCTATTGTTGGAATG
GTTGATGCCTTCCAGCTCCCGCAGCTTAACTCGTTCTCTTGTGTCTCGCCGCTCAACCTGAATGCTTAA
Gene >Pro_DTO377G3_2|g4889.t1
ATGAATCGCTTGGATGCAATTGAGCCACAATGGCCAACGGGGTCATCATTGTGCGAGGGTACCACGAGTGATAAT
GAGAATCATAGTCGGGTAATTGTGTTCAACGCACAAAGAGGGAAATCATGGAATCCTCTCAAGCTTGTTGCGATT
GGTTCCATCTCTATAGCGCTCTGGGTTGCGATAAGAGCAAGAGACCTAGTGCAGCCTCAAGATATCGATCCATTG
AACTTTGCGGCTCGAACGACCAGGGTATTATCGGAAATACCTCTCATAGATGGACATAACGATCTTCCATTCCTT
GTCCGACTGCAGCTCAACAATCAGATTTATGGAGACAACCTTCCATTTGATCAGGGTATAGTTTCTATTCGTTTG
CCAATCGTTTGATCAAGGACTAATTAATATTGGCTGTATGAAGGACTTGCATCTCATACAGATCTTAAGCGGATG
AAGCAGGGCAAAGTGGGTGGGCAGTTTTGGTCGGTCTTTGTAGAGGTGAGGTCCCTGACTATTGAGCATGCAGCA
TTACATGTGACTGACATCGAACCCAGTGTCCCCGAATACTTCATCTTGACGATCCAAATGTAATTGCAAATCTGG
CCCTTTCCCGCTCAAGAGCGATGTTGACAACTCCAATTTATAGCATAGTGTTCGTGATACCCTTGAGCAGATTGA
TGTGGCAAAGCGCTTGATAGCGGAATATAGCGAGCTGCAGTATTGCGACACAGCAGCATGTGCTCGACAAGCCTT
CAAATCAAAGAGAATATCTTCCATGCTCGGTGCTGAAGGACTCCATCAGATCGGTTCATCCCTTGCCGTGATCCG
GCAAATGTACGAGCTCGGGGTGCGCTATATCACTCTAACCCACAACTGTGACAATGCATTCGCTACTGCGGCCAG
CACAGTAACGGAAACAGGCAAGGATAATGGACTGAGTGACTTTGGACGTGCCGCGATACGCGAAATGAATCGCCT
AGGGATGATGATAGACCTCTCCCACACGTCTCACCGAACAATGCGAGATGCTATAGCTGCGACTCGGGCACCAGT
GATATTTTCCCATTCGGCGTGTTATGCGCTCGCAAAGCGTCTGAGAAATACCCCCGATGACGTCCTTCGGATGCT
CCGCCAAAATGGTGGCCTAATCATGATCTTTTTTGCGAACAAGTTCATTCGACCTGACAACCCGGACAAGGCCAG
TTTGGAAGACGTGGTCGATCACATATTCCATGCTGCCTCCATCGCCGGCTGGGACCATGTTGGAATTGGTGAGTG
GTTCGCTGTGAGTGTCGGAATAACACATACTAAATTGACCCAGGCAGCGATTTTGATGGGACACCTGCTGTTGCC
AGTGGGATCGAGGATGTCTCGGCATACCCGAGACTCATTGAAGCTGTCATGCGACGCGGTGCAACCGACGAGCAG
GTGCGAAAACTAGTGGGATTAAATATTCTGCGCGTTTGGGGGCAAAATGAGATTGTGTCGGCTCAAATACAGAGT
GAGATAGGCTCACGACCGGTGGAGAGTTATTGGGAGGGGAGGACACAACCAACTTGGGATGGCCCATTGCCTGCA
TTGAAGAAAATATCATAGCTTGAAATTATCGAATCCTGAACAAATGAATATCTTGTCTCCTTTCACTCTTAGAAA
ACAAAAACATCGACTCAGCTGATAAGGGGAACGCCCCCGCTTCTCGTCCGCCGCCCCCATCTTCCAGTCTTCCAC
GTGTGCGTGTGGTGAATATGTCTGGTCGTTCAAAGAGTACGCGGGCACAGCGGCCACCGAGAGTCGCATCCTGTG
AACCCTGTCGACTCTCTAAACTAGCCTGCGATCATCGCCAACCTTGCGCTCGGTGTGTCGGGCGAGATATCCCCC
ATGAGTGCGTCTACAGGAAGAATGCGTTCAAGCGGAGTCGACCCTCCTTTACACCCCAATCTCCGGGAATGCAGT
GCGTGATTCATTTAATCGGCCTCTATGTTATAAATTGCGTCCTGACGATCATTCCAGACATCAGCTGGCTTTTAA
TTCTACATCCATCCTAGAAGCCATCCAGCCAACTCTGCCACCAAATACACACCCTAATACGGGGTATCAAGGCTC
TTCTTCTCTAGACTCACTGTTAGGCAATGTACGCGAGCAAACCATGTTGTTTGGGGATCTGGAAGCTGCCTCGAC
CTTGCTTCCGGTCGGGCGGGATGATGAGGGGCCAGCTTACTCTACTCGTTTCATGAACAACGCTTCGACCGTCGA
GGGCGCACAGCTGCTAGAAACACTGACCAGCTCCAAGATAAATAACACCGTTATGCACTTTTTCTCGGACTGGAA
GGGGAACGGGCTCGAGTCGCATGTCGGCGCGATCCTCATTCAGCCATTCGCCGATGCAGTCATTGAGGAAATTGT
CACCCTACAGCATTCTAAAAATTTCCGATCCGATTTATTAGCTTTGTCACAGCGTTTGTTTGAAAATAGCAGCCG
CCCTGTGGAAATACATCGTTTGATGACGCTGCAAGGCCTCATCGACCAGTATACGGGTCCGAATCTCCGCTGGGA
GACAATGGGAGCAATCCTTACACTTGTTGGGTAGGGGAAAATCCCGGAAACTACTGTTCTAGAGATAAGGGGACT
AACAAGGGACATAGTATTGCCGCAACTGAGTTTCGTGCACCATATGCTCTGTACCGGACAGAACCAGAACGGCAG
ACCTTAAGAATGAACCTCATTCAATTTGGAAATAAATGCGCAATCTTTTGCGAGGCATTGGAGGTTCTCAATGAC
GTTCATATTCTCTTTCTGTATCAGACGTTCCAGGTGCAGTCTGTTTTTTATGGTGATCAAAGTACGCTACAAACT
CTTAATCTCCTTTCGCGTGTGACTCAAAGTGACAGATGGGCAGGTCTTAAAACGTGGCGCCGGCTCAACGACGCA
GCCTGTGCTCTACTTGCCGCTGGACTCCACGAGAGCATCCAAGAAGCGCGCGATGTTCCCTTCTTTCTGGTTGAA
CTAAGAAAACGTATTTTTTCCCGCTTATACAGTATCGATATCAGCCTAGCAACATTTCTCGGGCGACCACCGCGC
ATGAGCAAGAAATTTTGCTGTATCAACTTGCCCCTTGATATTGACGAGAAGTGTTATTCCCTGTCGGAGACTGCT
CTCAGTAGAGAGCTGGAAGATATTGATCACGCCGGCTGGAATTCGCAGGGTCACATCCGACCGAGTGCTGTTATG
CGATGGTCAACGATTACAGCAATGATTCGAGAAGAGACGTTGGAATTGCTTCTGGGCAGGAATATATATGATATG
CAACGGCGAATAATGTACGTGACTCGTCTCAGTTCGTGCAACACATTAGCTGATCGTTCACAGTGACTTGCACCA
TGAACTCAACAAGGCATGGGAGAACCTACCGTCCTTTCTGAGGGTGCCATCTCACGAACTCTGGGATATCCAAAG
ACCGCGCATGGAAATGGAGTGCTTACATATGACTCGGATTTTATATCTACAGTCTTCATTTTTGATCGAATGGGC
AGCATGGCGGCATGGACTCGAACACTCAAGTTTATTTCGCTCCGCAATGGAACTAATTTCCTCGGTTAATGATGC
CTTGGTCCGACGGGAACAGCTACCGAACCTTGGCTTTATATCTCTAGCCTGGAGAGTACGTACCCTGAGAAACTT
GTTAAATTATGTTGGGCTGACTTTATATATAGGTGGCATCCTGCGCTCTCCCTGCCGCCGGGGCCCTTGCACTAT
ATCTTCTACAGCCATCATCTCGATGTCGGTTCAAGGAATTAGACCCGCCGTCTCGACGACGGGTAATCGAGAATC
TGTCTGTTCTGATTGTACACATGGATATTTTGCATAGCCCCAGTGACGGTAATTTCAAATTGTTTTCCCAGGCCA
AGCGCTCTCTCCAGTCTGTTGTGGATATGCTATTACAACCGGTAAATCCACTTGGAATGGAAACATCACCTACAC
AGCTCAATGCCGAGATGCCCACCGCTGACTGGATGGTGCCTGACTATTGTGCATTCGATGGTGATTTCTGGTATG
TCAACACTTCACCAATTAGTGATTCACGCGCTAAAATTGCTACAGGGCGAATTTCCCCGATTGCCTCTATACAGA
GGAGAATAGCGATACTGCACTTGTATGAGAAGTATGAGAAGTACGGAAAGTCTCTTTAGCCAGATGCTGGTGATT
TTTTTTCTTGCTTTTTTTTTCTTTTTTTCTTTTTGGGCTCTTCTGTGTCTGATTGCATCAGGACATCTTGATTTT
GTCGCCTATAACATTGCGCATACCCTTCTTGCCATCATTTGAATCTGTATTTCTACGAGATGTTTCTATCCCACA
AATTATCTGATATATACGACCATAGGGTGTGAAAAATAGCCCGTAAAAATATACTGGCCGGTTACTGCGTATTGG
TGGATAAGATTGGCATTGTTAATACCGGGACGGAAGTATTTTCCCCCGATATCCACGTGACTGTGCGTCCCGTGC
TACGCTGTCCCGTGACTATTTTGTATTAGTCATTACATGTTTGACCATTCCAGCAATAAGCATCTATCAAGGAGA
ACCGAGTATTCGCTCAATGTGAGGGGGAAGGGGAGAGGTTAGCATCTATGAATGTAACTAGCCCTCCTGCACTCC
GTACAGCAGTGCCCATCATGAGATCTGAGGAATTAGGGCTGCACTCCGGATACCCCAGACACCAATCAAGCACTC
ACCTGTGGGCCTGAGGTTCCATCGAAACTTATCTTTCCTCCCCGTTAGCTCTCGCTCAATGGCCCTTTCTCCAGA
GTGACCCTCAATCAGGCAAGGATTATCAAAGACCGTTATCAATGGCTGGTTTATCGTTGCATTCATTTGGATTTA
TCGGTAGATTAATGCGTCCAACTGGTAGTCGCAGTCCCGCGATAGGAGACTTGGGCTCTCTCTCCGACAACACTC
CGAATTAATGCTTGTATACCTCGGAATTAATTAATTAACTTTGGACAGATGCTTATCTGCTTATCCCCCGCGCTT
GGTTTATATGACATTAAAAGGGATCAACTTTACCCACTTGGACAATGAATGTTCGCATCTGTCTCACACTATACA
TTCTCATTTGAAGCCTATTCTACACTCACTGTCGATGAATATGGAACTCTCTTTGGACGAGAAAGAGGGCGGTTT
CATGCCAGAATCGCCTCGGGAGTTGACTTCGCCTGGAGAGTTGACTTCAACAACCCTCATCAAACCACAGGCTCG
CGACGCTTACGATCCAAATATCACATTCGAGGAGTACCATTACTATTCGAAGAAGACAAGAGAAGAGGAAGAGCT
TTTGGAGCCTCCGGTGCTCAATATCCGACAGCTTCTCTCAGGCAAAAAGACCGAAGAAGGGCCAATTACAACACT
GACAGAGAAAGACTTTTCAACTCGCGAGCGGAGACTTGCAATCACAGACGAGGAATGGACAAATGCAAGCCGTTC
GCTTAGGTCTGCCTCATGGGGTGCCTGTAAGTCGGCAATTGTATCTTTTGAACTCCATACTTACAAGACTGCTAG
GTTTCTATTTGATCACAACGGATATTCTCGGCCCGTATGGCGCGGGCTTTGCAATGGGCACGTTGGGTTGGGGAC
CAGGTTAGTATTTATTCCTGTACACATCTGGAACACTGAGTTGACTGATTGGGATATAGGCATTGCCTTCTACAC
CGTTTTCGGATTCATGGCCGGATACTCTGGATATCTCCTTTGGCGTGTCTTCCTCGGCGTGGACAGCTACGAGTT
CCCGGCCAAGAACTATGGTGATCTCGGATTCCGGACGCTTGGTCGGTACGGTCGCCATCTTACAAATGTCTCTCA
GGCGATCTCGCTACTCTTGCTTGTGGGCCAAGTCACGATCGGATTTGGCGAAAACATCTCTCAAGTATCACAGTT
CCGACTCTGCTATGTTGTCTGTCCCGTCATCTTTGCTTGTGTCGGCTTCTTTGTTTCTCAGATCAGGACTCTCAA
AGCGTATGGCTGGATTGCAAATCTCGCAGTGTGGATGAATTTGTTTGTCATCTTCATGACTATGGGTGTGATGTC
GATGTCTCCACCGAACTACAAAATTTCCACGCTCGGGTCAGCTGGCAGTGCGGTTGACAGAGCAACGATCACACC
GGATAGTGAGGGTAACTACCCGCCGATCATGCATTACAACAATATCCCCACGGATGGACTCATTGGGTCGGTGAA
TGGCATGCTTTCCGGTGTGCTGGCATATGCAGGTGCACAGCTGTTTGTCGAATTCATGGCCGAAATGCGGCGGCC
TCGAGACTTCCTCAAAGCTATGTGGGGAGCCCAGTTTTTCATCTACAGCGTCTATCTCACTCACGGATGCGTCGT
CTATCATCTCCAAGGACAGTACAGCTTCAGTCCGAGTTACCAGGGTATCAGCGTCTACTCGTGGCAAACCGTCGG
CAACATGGTTTCTTTGCTCTCTGCTCTGATCTGCGCAGGCCTCTACGGAAATATTGGAGTCAAGATCGTCTACAA
TAACGTCTTGATGGATATTTTCGGTATGCCTCCTCTGAATACCCGGGTTGGCAAAATTGTCTATGCTTCTCTCGT
CCCAATTTGGTGGACGATCGCCTTTATCATTGCCGCAGCCGTTCCAGATTACTTTGGCTTCGTCAGCATCATTTC
CGCTTCCATGCTTTTGAACTTGACATTTACCATACCTCCCTTGTTTGCCCTTGCATTTGACATCCAGAAGAATGC
TATTCGACCGGAGATTGGTGAAGGATTCAACCCGACAACCGGAGAGGTGATCCGGACCGAATCAACAACGGCAAG
ATGGGTCCGCGGTTTCTTTTCTGGCGGCACCTTCCAAGTCGCCACCAACGTTTGGCATATTGTGTTCTGCTTAGC
ATCACTCTCGATGTGTGGACTGGGCATGTGGGCGGCTATTGTTGGTGAGTTATTATGCTTTCTTGTTATTTACTC
CATACTAATTTCTCTCCTAGGAATGGTTGATGCCTTCCAGCTCCCGCAGCTTAACTCGTTCTCTTGTGTCTCGCC
GCTCAACCTGAATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail