Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g488.t1
Gene name
Locationscaffold_01:1241208..1243399
Strand-
Gene length (bp)2191
Transcript length (bp)1755
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.1E-20 271 373
PF00153 Mito_carr Mitochondrial carrier protein 1.2E-20 384 476
PF00153 Mito_carr Mitochondrial carrier protein 5.2E-21 492 581
PF13499 EF-hand_7 EF-hand domain pair 3.0E-11 85 140
PF13202 EF-hand_5 EF hand 2.4E-04 57 75
PF13202 EF-hand_5 EF hand 2.4E-04 86 105
PF13202 EF-hand_5 EF hand 8.4E-05 120 142
PF13833 EF-hand_8 EF-hand domain pair 1.2E-03 46 76
PF13833 EF-hand_8 EF-hand domain pair 1.5E-02 95 142

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 85.86 52.69 119.02
5d_25C Five days - 25 degrees Celsius 117.73 71.35 164.10
7d_25C Seven days - 25 degrees Celsius 120.55 73.27 167.84
10d_25C Ten days - 25 degrees Celsius 152.85 91.90 213.81
7d_15C Seven days - 15 degrees Celsius 142.39 84.29 200.49
7d_30C Seven days - 30 degrees Celsius 96.12 58.55 133.69

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.143169 no
3d_25C 7d_25C 0.104886 no
3d_25C 7d_15C 0.012609 yes
3d_25C 7d_30C 0.682402 no
3d_25C 10d_25C 0.003625 yes
5d_25C 7d_25C 0.942559 no
5d_25C 7d_15C 0.444283 no
5d_25C 7d_30C 0.400869 no
5d_25C 10d_25C 0.255838 no
7d_25C 7d_15C 0.523239 no
7d_25C 7d_30C 0.340353 no
7d_25C 10d_25C 0.310229 no
7d_15C 7d_30C 0.069248 no
7d_15C 10d_25C 0.821292 no
7d_30C 10d_25C 0.026091 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g488.t1
MASGESKDERDKRVAKLWETLDTRREGHIDLNGLKKGLKKIDHPLKNADDMVLRVAREVDTNGDGRIDQAEFRAF
INRTEDGLWQMFQSIDRNKNGEIDKMELRNAFSRSGVTVSSAKLDRFFAEVDKNHDGVISYTEWRDFLLFLPLQS
PTDLRAVLSYYTATGNLNPEGDVNINDLQGLGTNHPFLSSCIPAIQHVLYNFLSLPALAPFLPSAHAQTSHISKP
EPVLEHEFVSLDADLDLEWLPLPQTTAMRMSFRYHGRKLTENTPQLGYFLAGGMAGAVSRTATAPLDRLKIYLIA
QTSVKSTVQAAKDGSLLTAVGNDPRTLFGALKELWRAGGIRSLFAGNGLNVVKVMPESAIKFGAYESAKRAFAQL
EGHNDPKRLRPTSQFMSGGFGGMVAQCFVYPLDTLKFRMQCETVKGGPKGNQLIAATARKVWNKNGLAGFFRGLP
LGLVGMFPYAAIDLSTFEYLKRALIAKKARDCGCHEDDVPLGNFATGAIGAMSGGFSASIVYPLNVLRTRLQTQG
TILHPPTYTGIGEVLSVTLKAEGPRGLYKGLTPNLLKVAPAMSISYVVYENAKRILGLR*
Coding >Pro_DTO377G3_2|g488.t1
ATGGCATCCGGAGAGTCAAAAGATGAACGCGACAAACGAGTCGCCAAACTCTGGGAAACCTTGGACACTCGACGA
GAGGGCCATATCGACCTGAATGGGTTAAAGAAGGGGTTAAAGAAAATTGATCATCCTCTAAAAAATGCAGACGAT
ATGGTACTCAGGGTCGCGCGGGAGGTGGATACGAATGGTGATGGACGTATCGACCAAGCCGAATTCCGAGCATTC
ATCAACCGCACCGAGGACGGACTATGGCAGATGTTCCAGAGCATTGATCGAAATAAAAACGGAGAAATCGACAAG
ATGGAATTGCGGAATGCCTTTTCACGTTCCGGGGTCACAGTCTCGAGCGCCAAGTTGGACCGGTTTTTCGCGGAA
GTCGATAAGAACCATGACGGCGTGATCTCTTACACTGAGTGGAGGGATTTCCTTCTATTCCTCCCTCTCCAATCC
CCGACCGACCTACGCGCAGTCCTTTCATACTATACGGCCACGGGCAATCTAAACCCGGAAGGAGATGTCAACATC
AATGACCTGCAGGGTTTAGGTACAAATCATCCGTTTCTTTCATCTTGTATTCCGGCCATCCAACACGTTTTGTAC
AACTTTTTGTCCCTCCCCGCCTTGGCCCCCTTCCTTCCTTCAGCACACGCACAAACCAGCCATATCTCAAAACCG
GAACCCGTTCTCGAGCATGAATTTGTCTCGCTAGACGCCGACTTGGATTTGGAATGGCTGCCTCTTCCCCAGACT
ACCGCCATGCGGATGTCTTTCCGATATCATGGACGGAAGTTGACCGAAAATACCCCTCAATTAGGCTACTTCCTT
GCAGGTGGAATGGCGGGTGCCGTGTCAAGGACGGCCACCGCCCCCCTCGATCGTCTCAAAATCTATCTCATTGCG
CAGACTAGCGTCAAATCAACGGTTCAGGCGGCGAAGGACGGATCCCTGTTGACTGCGGTGGGGAACGATCCCAGA
ACATTGTTCGGCGCTCTCAAGGAACTATGGCGGGCTGGAGGAATACGGAGTTTGTTCGCAGGCAATGGCTTGAAC
GTGGTAAAGGTTATGCCAGAGTCTGCGATCAAGTTTGGTGCCTATGAGTCTGCGAAACGAGCATTTGCACAACTC
GAAGGACACAATGATCCCAAGCGACTTCGTCCCACTTCACAGTTCATGTCGGGTGGCTTTGGTGGAATGGTTGCC
CAATGTTTTGTTTACCCCCTCGATACCCTAAAATTTCGCATGCAATGCGAAACCGTGAAAGGTGGCCCGAAAGGC
AATCAACTCATCGCAGCTACCGCAAGAAAGGTATGGAATAAGAATGGCTTGGCTGGCTTCTTCCGAGGACTACCG
CTTGGCCTTGTGGGGATGTTCCCCTACGCCGCAATCGATCTATCGACATTTGAATACCTCAAACGAGCACTCATA
GCTAAAAAGGCTCGTGACTGTGGCTGCCATGAGGATGACGTTCCCCTCGGCAACTTCGCGACAGGTGCAATTGGT
GCTATGAGTGGAGGATTCAGCGCCTCGATTGTCTACCCACTCAATGTTCTCCGCACTCGACTTCAAACTCAAGGC
ACGATTTTGCATCCGCCTACATACACAGGGATTGGTGAAGTCCTAAGCGTCACACTCAAAGCAGAGGGACCCCGT
GGTCTTTACAAAGGTCTCACACCTAATCTTCTCAAAGTGGCACCGGCCATGTCAATCAGCTACGTGGTCTACGAG
AACGCGAAACGCATTCTCGGCCTACGATGA
Transcript >Pro_DTO377G3_2|g488.t1
ATGGCATCCGGAGAGTCAAAAGATGAACGCGACAAACGAGTCGCCAAACTCTGGGAAACCTTGGACACTCGACGA
GAGGGCCATATCGACCTGAATGGGTTAAAGAAGGGGTTAAAGAAAATTGATCATCCTCTAAAAAATGCAGACGAT
ATGGTACTCAGGGTCGCGCGGGAGGTGGATACGAATGGTGATGGACGTATCGACCAAGCCGAATTCCGAGCATTC
ATCAACCGCACCGAGGACGGACTATGGCAGATGTTCCAGAGCATTGATCGAAATAAAAACGGAGAAATCGACAAG
ATGGAATTGCGGAATGCCTTTTCACGTTCCGGGGTCACAGTCTCGAGCGCCAAGTTGGACCGGTTTTTCGCGGAA
GTCGATAAGAACCATGACGGCGTGATCTCTTACACTGAGTGGAGGGATTTCCTTCTATTCCTCCCTCTCCAATCC
CCGACCGACCTACGCGCAGTCCTTTCATACTATACGGCCACGGGCAATCTAAACCCGGAAGGAGATGTCAACATC
AATGACCTGCAGGGTTTAGGTACAAATCATCCGTTTCTTTCATCTTGTATTCCGGCCATCCAACACGTTTTGTAC
AACTTTTTGTCCCTCCCCGCCTTGGCCCCCTTCCTTCCTTCAGCACACGCACAAACCAGCCATATCTCAAAACCG
GAACCCGTTCTCGAGCATGAATTTGTCTCGCTAGACGCCGACTTGGATTTGGAATGGCTGCCTCTTCCCCAGACT
ACCGCCATGCGGATGTCTTTCCGATATCATGGACGGAAGTTGACCGAAAATACCCCTCAATTAGGCTACTTCCTT
GCAGGTGGAATGGCGGGTGCCGTGTCAAGGACGGCCACCGCCCCCCTCGATCGTCTCAAAATCTATCTCATTGCG
CAGACTAGCGTCAAATCAACGGTTCAGGCGGCGAAGGACGGATCCCTGTTGACTGCGGTGGGGAACGATCCCAGA
ACATTGTTCGGCGCTCTCAAGGAACTATGGCGGGCTGGAGGAATACGGAGTTTGTTCGCAGGCAATGGCTTGAAC
GTGGTAAAGGTTATGCCAGAGTCTGCGATCAAGTTTGGTGCCTATGAGTCTGCGAAACGAGCATTTGCACAACTC
GAAGGACACAATGATCCCAAGCGACTTCGTCCCACTTCACAGTTCATGTCGGGTGGCTTTGGTGGAATGGTTGCC
CAATGTTTTGTTTACCCCCTCGATACCCTAAAATTTCGCATGCAATGCGAAACCGTGAAAGGTGGCCCGAAAGGC
AATCAACTCATCGCAGCTACCGCAAGAAAGGTATGGAATAAGAATGGCTTGGCTGGCTTCTTCCGAGGACTACCG
CTTGGCCTTGTGGGGATGTTCCCCTACGCCGCAATCGATCTATCGACATTTGAATACCTCAAACGAGCACTCATA
GCTAAAAAGGCTCGTGACTGTGGCTGCCATGAGGATGACGTTCCCCTCGGCAACTTCGCGACAGGTGCAATTGGT
GCTATGAGTGGAGGATTCAGCGCCTCGATTGTCTACCCACTCAATGTTCTCCGCACTCGACTTCAAACTCAAGGC
ACGATTTTGCATCCGCCTACATACACAGGGATTGGTGAAGTCCTAAGCGTCACACTCAAAGCAGAGGGACCCCGT
GGTCTTTACAAAGGTCTCACACCTAATCTTCTCAAAGTGGCACCGGCCATGTCAATCAGCTACGTGGTCTACGAG
AACGCGAAACGCATTCTCGGCCTACGATGA
Gene >Pro_DTO377G3_2|g488.t1
ATGGCATCCGGAGAGTCAAAAGATGAACGCGACAAACGAGTCGCCAAACTCTGGGAAACCTTGGACACTCGACGA
GAGGGCCATATCGACCTGAATGGGTTAAAGAAGGGGTTAAAGAAAATTGATCATCGTGAGTTGGACCTGGTTTCT
TGCTCTATATCTACGCTTGTCTAATCTCTTTCTAGCTCTAAAAAATGCAGACGATATGGTACTCAGGGTCGCGCG
GGAGGTGGATACGAATGGTGATGGACGTATCGACCAAGCCGGTAAGCTCACGAGAACCACCTAGGGATCACTCGG
CGAAGGGGTGCCCTGGCCAAGATTTGGTCCAATCCTAATCACCACCAGAATTCCGAGCATTCATCAACCGCACCG
AGGACGGACTATGGCAGATGTTCCAGAGCATTGATCGAAATAAAAACGGAGAAATCGACAAGATGGAATTGCGGA
ATGCCTTTTCACGTTCCGGGGTCACAGTCTCGAGCGCCAAGTTGGACCGGTTTTTCGCGGAAGTCGATAAGAACC
ATGACGGCGTGATCTCTTACACTGAGTGGAGGTATACGCATCCTCACTCTGGTCAATGAAGGCTGAAAAATCCTA
GGCTAACAAATTTACCCTTCTCTTTTTTTTAGGGATTTCCTTCTATTCCTCCCTCTCCAATCCCCGACCGACCTA
CGCGCAGTCCTTTCATACTATACGGCCACGGGCAATCTAAACCCGGAAGGAGATGTCAACATCAATGACCTGCAG
GGTTTAGGTACAAATCATCCGTTTCTTTCATCTTGTATTCCGGCCATCCAACACGTTTTGTACAACTTTTTGTCC
CTCCCCGCCTTGGCCCCCTTCCTTCCTTCAGCACACGCACAAACCAGCCATATCTCAAAACCGGAACCCGTTCTC
GAGCATGAATTTGTCTCGCTAGACGCCGACTTGGATTTGGAATGGCTGCCTCTTCCCCAGACTACCGCCATGCGG
ATGTCTTTCCGATATCATGGACGGAAGTTGACCGAAAATACCCCTCAATTAGGCTACTTCCTTGCAGGTGGAATG
GCGGGTGCCGTGTCAAGGACGGCCACCGCCCCCCTCGATCGTCTCAAAATCTATCTCATTGCGCAGACTAGCGTC
AAATCAACGGTTCAGGCGGCGAAGGACGGATCCCTGTTGACTGCGGTGGGGAACGATCCCAGAACATTGTTCGGC
GCTCTCAAGGAACTATGGCGGGCTGGAGGAATACGGAGTTTGTTCGCAGGTTTGTCATATTGTCAACCTGGACTC
GAAGTGGCAGCGACTAACTATAAGTAGGCAATGGCTTGAACGTGGTAAAGGTTATGCCAGAGTCTGCGATCAAGT
TTGGTGCCTATGAGGTTTGTAATCTTGCTATTCGATTTCGCCTACACAACTAGACGAATACTGACCAGAGAACAG
TCTGCGAAACGAGCATTTGCACAACTCGAAGGACACAATGATCCCAAGCGACTTCGTCCCACTTCACAGTTCATG
TCGGGTGGCTTTGGTGGAATGGTTGCCCAGTAGGTCTTGCGCGTTATCTATGAAAGGCAAGTCGGTTCTGATTGT
GACTAGATGTTTTGTTTACCCCCTCGATACCCTAAAATTGTGAGTACATCGACCAAAGTGAGTTGTGAGAGCATT
GTGGCTCATAGTTATCAATAGTCGCATGCAATGCGAAACCGTGAAAGGTGGCCCGAAAGGCAATCAACTCATCGC
AGCTACCGCAAGAAAGGTATGGAATAAGAATGGCTTGGCTGGCTTCTTCCGAGGACTACCGCTTGGCCTTGTGGG
GATGTTCCCCTACGCCGCAATCGATCTATCGACATTTGAATACCTCAAACGAGCACTCATAGCTAAAAAGGCTCG
TGACTGTGGCTGCCATGAGGATGACGTTCCCCTCGGCAACTTCGCGACAGGTGCAATTGGTGCTATGAGTGGAGG
ATTCAGCGCCTCGATTGTCTACCCACTCAATGTTCTCCGCACTCGACTTCAAACTCAAGGCACGATTTTGCATCC
GCCTACATACACAGGGATTGGTGAAGTCCTAAGCGTCACACTCAAAGCAGAGGGACCCCGTGGTCTTTACAAAGG
TCTCACACCTAATCTTCTCAAAGTGGCACCGGCCATGTCAATCAGCTACGTGGTCTACGAGAACGCGAAACGCAT
TCTCGGCCTACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail