Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4878.t1
Gene name
Locationscaffold_10:626162..627538
Strand+
Gene length (bp)1376
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00162 PGK Phosphoglycerate kinase 2.8E-151 9 406

GO

GO Term Description Terminal node
GO:0006096 glycolytic process Yes
GO:0004618 phosphoglycerate kinase activity Yes
GO:0006090 pyruvate metabolic process No
GO:0009056 catabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0008152 metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009135 purine nucleoside diphosphate metabolic process No
GO:0006165 nucleoside diphosphate phosphorylation No
GO:0016740 transferase activity No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019693 ribose phosphate metabolic process No
GO:0009185 ribonucleoside diphosphate metabolic process No
GO:0016774 phosphotransferase activity, carboxyl group as acceptor No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0003824 catalytic activity No
GO:0046939 nucleotide phosphorylation No
GO:0019637 organophosphate metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0009987 cellular process No
GO:0046034 ATP metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016310 phosphorylation No
GO:1901135 carbohydrate derivative metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0009179 purine ribonucleoside diphosphate metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:1901575 organic substance catabolic process No
GO:0046031 ADP metabolic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009132 nucleoside diphosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0006757 ATP generation from ADP No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016301 kinase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4878.t1
MSLANKLPITDVDLKGKRVLIRVDFNVPLDDNKNVTNSQRIVGALPTIKYAIDNGAKAVVLMSHLGRPNGKVNPK
YSLKPVVPVLEKLLGKDVTFVDDCVGPQTEETVNKASGGQVILLENLRFHAEEEGSSKDAEGNKVKADKADVDAF
RKGLTALGDVYVNDAFGTAHRAHSSMVGVDLPQKAAGFLMKKELEYFAKALENPARPFLAILGGAKVSDKILLID
NLLPKVNSLIITGGMAFTFKKTLENVKIGNSLFDEAGSKLVGEIVEKAKKYNVEIVLPVDYVTADKFSADATVGA
ATDATGIPDGFMGLDVGPESVKLYQKTIAEAKTILWNGPPGVFELKPFAKGTEATLDAAVKAAESGSIVIIGGGD
TATVAAKYKVEDKISHVSTGGGASLELLEGKELPGVTALSSK*
Coding >Pro_DTO377G3_2|g4878.t1
ATGTCTCTCGCCAACAAGCTCCCCATTACTGATGTCGACCTCAAGGGCAAGCGTGTCTTGATCCGGGTTGACTTC
AATGTTCCCCTCGATGATAACAAGAACGTTACCAACTCTCAGCGTATCGTTGGTGCCCTGCCCACCATCAAGTAT
GCCATCGACAACGGTGCCAAGGCCGTTGTGCTCATGTCTCACCTCGGCCGCCCCAATGGCAAGGTCAACCCCAAG
TACAGCTTGAAGCCCGTTGTTCCCGTGCTTGAGAAGCTTCTCGGCAAGGACGTCACTTTCGTCGACGACTGCGTT
GGTCCCCAGACTGAGGAGACCGTGAACAAGGCTTCCGGTGGCCAGGTCATTCTGCTTGAGAACCTCCGTTTCCAT
GCTGAGGAGGAGGGCAGCTCTAAGGACGCCGAGGGCAATAAGGTCAAGGCCGACAAGGCCGATGTTGATGCATTC
CGCAAGGGCCTCACTGCCCTCGGTGACGTTTACGTCAACGATGCTTTCGGTACCGCACACCGCGCTCACAGCTCC
ATGGTCGGCGTGGACCTACCCCAGAAGGCTGCCGGCTTCCTCATGAAGAAGGAGCTGGAGTACTTCGCCAAGGCT
CTTGAGAACCCTGCGCGCCCCTTCCTCGCCATCCTCGGTGGTGCCAAGGTGTCTGACAAGATCCTGCTGATTGAC
AACCTCCTGCCTAAGGTTAACAGCCTCATCATCACCGGTGGCATGGCCTTCACCTTCAAGAAGACTCTTGAGAAC
GTCAAGATCGGCAACAGTCTCTTCGACGAGGCCGGCAGCAAGTTAGTCGGCGAGATTGTCGAGAAGGCCAAGAAG
TACAACGTCGAGATCGTCCTCCCCGTTGACTACGTCACCGCCGATAAGTTCTCTGCCGACGCCACCGTTGGTGCG
GCTACTGACGCTACCGGTATCCCCGACGGCTTCATGGGTCTGGATGTTGGCCCCGAGAGTGTCAAGCTCTACCAG
AAGACCATTGCCGAGGCCAAGACCATCCTCTGGAACGGCCCCCCCGGTGTCTTCGAGCTCAAGCCCTTCGCCAAG
GGTACCGAGGCTACCCTCGATGCCGCTGTCAAGGCTGCCGAGTCCGGTTCCATCGTCATCATCGGTGGCGGTGAT
ACCGCTACCGTGGCCGCCAAGTACAAGGTCGAGGACAAGATCTCTCACGTTTCGACCGGTGGCGGTGCCTCGCTC
GAGCTTCTCGAAGGCAAGGAGCTGCCTGGTGTTACTGCTCTGTCTAGTAAGTAA
Transcript >Pro_DTO377G3_2|g4878.t1
ATGTCTCTCGCCAACAAGCTCCCCATTACTGATGTCGACCTCAAGGGCAAGCGTGTCTTGATCCGGGTTGACTTC
AATGTTCCCCTCGATGATAACAAGAACGTTACCAACTCTCAGCGTATCGTTGGTGCCCTGCCCACCATCAAGTAT
GCCATCGACAACGGTGCCAAGGCCGTTGTGCTCATGTCTCACCTCGGCCGCCCCAATGGCAAGGTCAACCCCAAG
TACAGCTTGAAGCCCGTTGTTCCCGTGCTTGAGAAGCTTCTCGGCAAGGACGTCACTTTCGTCGACGACTGCGTT
GGTCCCCAGACTGAGGAGACCGTGAACAAGGCTTCCGGTGGCCAGGTCATTCTGCTTGAGAACCTCCGTTTCCAT
GCTGAGGAGGAGGGCAGCTCTAAGGACGCCGAGGGCAATAAGGTCAAGGCCGACAAGGCCGATGTTGATGCATTC
CGCAAGGGCCTCACTGCCCTCGGTGACGTTTACGTCAACGATGCTTTCGGTACCGCACACCGCGCTCACAGCTCC
ATGGTCGGCGTGGACCTACCCCAGAAGGCTGCCGGCTTCCTCATGAAGAAGGAGCTGGAGTACTTCGCCAAGGCT
CTTGAGAACCCTGCGCGCCCCTTCCTCGCCATCCTCGGTGGTGCCAAGGTGTCTGACAAGATCCTGCTGATTGAC
AACCTCCTGCCTAAGGTTAACAGCCTCATCATCACCGGTGGCATGGCCTTCACCTTCAAGAAGACTCTTGAGAAC
GTCAAGATCGGCAACAGTCTCTTCGACGAGGCCGGCAGCAAGTTAGTCGGCGAGATTGTCGAGAAGGCCAAGAAG
TACAACGTCGAGATCGTCCTCCCCGTTGACTACGTCACCGCCGATAAGTTCTCTGCCGACGCCACCGTTGGTGCG
GCTACTGACGCTACCGGTATCCCCGACGGCTTCATGGGTCTGGATGTTGGCCCCGAGAGTGTCAAGCTCTACCAG
AAGACCATTGCCGAGGCCAAGACCATCCTCTGGAACGGCCCCCCCGGTGTCTTCGAGCTCAAGCCCTTCGCCAAG
GGTACCGAGGCTACCCTCGATGCCGCTGTCAAGGCTGCCGAGTCCGGTTCCATCGTCATCATCGGTGGCGGTGAT
ACCGCTACCGTGGCCGCCAAGTACAAGGTCGAGGACAAGATCTCTCACGTTTCGACCGGTGGCGGTGCCTCGCTC
GAGCTTCTCGAAGGCAAGGAGCTGCCTGGTGTTACTGCTCTGTCTAGTAAGTAA
Gene >Pro_DTO377G3_2|g4878.t1
ATGTCTCTCGCCAACAAGCTCCCCATTACTGATGTCGACCTCAAGGGCAAGCGTGTCTTGATCCGGGTAAGCTTC
TAGCTCATTGAGCTTCATTACTCGCAGCTCCTAACCGCTGACTGAAACAGGTTGACTTCAATGTTCCCCTCGATG
ATAACAAGAACGTTACCAACTCTCAGCGTATCGTTGGTGCCCTGCCCACCATCAAGTATGCCATCGACAACGGTG
CCAAGGCCGTTGTGCTCATGTCTCACCTCGGCCGCCCCAATGGCAAGGTCAACCCCAAGTACAGCTTGAAGCCCG
TTGTTCCCGTGCTTGAGAAGCTTCTCGGCAAGGACGTCACTTTCGTCGACGACTGCGTTGGTCCCCAGACTGAGG
AGACCGTGAACAAGGCTTCCGGTGGCCAGGTCATTCTGCTTGAGAACCTCCGTTTCCATGCTGAGGAGGAGGGCA
GCTCTAAGGACGCCGAGGGCAATAAGGTCAAGGCCGACAAGGCCGATGTTGATGCATTCCGCAAGGGCCTCACTG
CCCTCGGTGACGTTTACGTCAGTATGTAACACCACGACTCTATTACTATTTCTTGTCGTTCATTTATCTCTAACA
TCAATCCAGACGATGCTTTCGGTACCGCACACCGCGCTCACAGCTCCATGGTCGGCGTGGACCTACCCCAGAAGG
CTGCCGGCTTCCTCATGAAGAAGGAGCTGGAGTACTTCGCCAAGGCTCTTGAGAACCCTGCGCGCCCCTTCCTCG
CCATCCTCGGTGGTGCCAAGGTGTCTGACAAGATCCTGCTGATTGACAACCTCCTGCCTAAGGTTAACAGCCTCA
TCATCACCGGTGGCATGGCCTTCACCTTCAAGAAGACTCTTGAGAACGTCAAGATCGGCAACAGTCTCTTCGACG
AGGCCGGCAGCAAGTTAGTCGGCGAGATTGTCGAGAAGGCCAAGAAGTACAACGTCGAGATCGTCCTCCCCGTTG
ACTACGTCACCGCCGATAAGTTCTCTGCCGACGCCACCGTTGGTGCGGCTACTGACGCTACCGGTATCCCCGACG
GCTTCATGGGTCTGGATGTTGGCCCCGAGAGTGTCAAGCTCTACCAGAAGACCATTGCCGAGGCCAAGACCATCC
TCTGGAACGGCCCCCCCGGTGTCTTCGAGCTCAAGCCCTTCGCCAAGGGTACCGAGGCTACCCTCGATGCCGCTG
TCAAGGCTGCCGAGTCCGGTTCCATCGTCATCATCGGTGGCGGTGATACCGCTACCGTGGCCGCCAAGTACAAGG
TCGAGGACAAGATCTCTCACGTTTCGACCGGTGGCGGTGCCTCGCTCGAGCTTCTCGAAGGCAAGGAGCTGCCTG
GTGTTACTGCTCTGTCTAGTAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail