Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4876.t1
Gene name
Locationscaffold_10:621749..623641
Strand+
Gene length (bp)1892
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12735 Trs65 TRAPP trafficking subunit Trs65 2.0E-101 274 566

GO

GO Term Description Terminal node
GO:1990071 TRAPPII protein complex Yes
GO:0006891 intra-Golgi vesicle-mediated transport Yes
GO:0099023 vesicle tethering complex No
GO:0048193 Golgi vesicle transport No
GO:0008150 biological_process No
GO:0140535 intracellular protein-containing complex No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0016192 vesicle-mediated transport No
GO:0030008 TRAPP complex No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4876.t1
MPGLEIPGEFLRHAILDTVVLHAPAFDIERALSSALEDGADDLPSVLSSIPQRSLLFFDEFLPVRIILRLSDCSE
TTLKHYLPRLEVKLDVFAVDPAESVGENLTPTRDIIFSGIVGRDEDPLVVFNEFEGDEGSGNHVYLVWNIETILR
RPRIRIQHPSLLFIASASLNPADARRRENSGDDYLPSLVPASTNMLQSLSTDKSFNHKEPFLPASRLLRVVPTTY
DEDPIYNIQQQHGHPFRVVPAASARIRYSRLSSYTAIPMTVASLDFEVTPYLACEVSFDKANLHLSEGTIESLSD
TPGLALPITCRPRDDVTLMYKLTPEYGPETNPSSTALVSTLDISLEAAILVDDDCKPRISMQWRTNVDFSVALNP
NFGGPSPALQRTNRPTSLSVSTQVGVNPHRSSLRERAYSVTDVGITISFSGPVRVQVGCVFSWDVFIVNRSNAPR
KFALIAIPKRKSVDPRGHVARPSSSSITSRKEDQVAEAVTDDNIVHARQKSVAGQEVELISLSTDIRVGPLLPGT
CHSTELKLLPLATGPLHLEAVRLVDVNTNETTDIRDLPDILADDQPRSS*
Coding >Pro_DTO377G3_2|g4876.t1
ATGCCTGGTCTGGAGATCCCAGGTGAATTCTTGCGTCATGCAATTCTTGATACCGTCGTGCTTCATGCTCCAGCA
TTTGACATTGAGCGCGCCCTGAGTTCGGCCCTAGAGGACGGAGCTGATGATCTCCCCTCTGTTCTCTCGTCAATC
CCCCAACGGTCTCTATTGTTCTTTGATGAATTTTTGCCTGTCCGTATCATCTTGAGACTATCTGATTGCTCAGAA
ACGACCTTGAAACACTACCTGCCACGACTCGAAGTCAAGCTCGATGTCTTTGCTGTCGATCCAGCAGAATCAGTT
GGCGAAAACCTCACGCCAACTCGCGATATAATATTCTCAGGAATTGTCGGTCGAGATGAGGATCCCCTAGTAGTC
TTCAATGAATTCGAAGGTGATGAAGGCAGTGGGAATCATGTCTATTTGGTTTGGAACATCGAGACTATACTGCGG
CGTCCCCGTATTCGAATCCAACATCCGTCACTCTTATTCATTGCGTCTGCCAGTCTGAATCCGGCTGACGCTCGC
CGTCGAGAGAATTCGGGGGATGACTATCTCCCCTCACTCGTCCCCGCATCGACCAATATGCTGCAATCTCTATCC
ACTGATAAATCTTTCAATCATAAAGAGCCTTTCCTCCCCGCTTCCAGACTATTGAGGGTTGTACCGACAACATAC
GACGAAGACCCGATTTACAATATCCAGCAACAACACGGTCACCCCTTTCGCGTTGTGCCAGCCGCAAGCGCAAGG
ATTCGATACTCTCGGTTAAGCTCCTACACGGCTATACCGATGACCGTGGCCAGTCTTGACTTTGAGGTCACCCCT
TATCTGGCTTGCGAGGTCTCCTTTGACAAAGCGAATCTTCACCTGTCCGAGGGAACGATTGAGTCGCTTTCAGAC
ACACCGGGCCTGGCTCTTCCTATTACTTGCCGTCCGCGAGACGATGTGACCCTCATGTATAAACTTACACCGGAG
TATGGCCCAGAGACCAATCCATCATCTACCGCGTTAGTCAGCACGCTGGACATATCTCTCGAGGCAGCAATTCTT
GTGGATGACGACTGCAAGCCACGTATTTCTATGCAGTGGAGAACCAACGTCGATTTCTCAGTCGCCCTAAATCCG
AATTTTGGGGGGCCCAGTCCAGCGCTGCAAAGGACCAACCGCCCTACCAGTCTATCGGTGTCAACCCAAGTGGGT
GTGAACCCTCATCGAAGCTCATTGCGAGAACGAGCATATTCGGTCACCGACGTGGGTATCACAATCTCATTCTCT
GGACCTGTTCGTGTGCAAGTGGGCTGTGTCTTCTCTTGGGATGTTTTTATTGTCAATCGATCAAACGCTCCTCGA
AAGTTTGCCTTGATCGCCATACCCAAGCGGAAAAGCGTGGACCCACGAGGCCATGTTGCTCGGCCTTCATCGTCA
TCTATCACCAGCCGGAAAGAGGACCAAGTGGCCGAGGCGGTAACTGACGATAATATCGTGCATGCGAGGCAAAAG
AGTGTGGCTGGTCAGGAAGTGGAACTGATCAGCTTGAGCACAGACATTCGCGTGGGCCCCCTCCTCCCAGGAACT
TGCCATTCGACTGAACTCAAACTCCTTCCCCTAGCTACAGGCCCACTTCATTTGGAGGCGGTCCGGCTTGTAGAT
GTGAACACGAACGAAACGACTGATATCCGAGATCTTCCGGACATTTTGGCGGATGATCAGCCTCGCTCTAGTTAA
Transcript >Pro_DTO377G3_2|g4876.t1
ATGCCTGGTCTGGAGATCCCAGGTGAATTCTTGCGTCATGCAATTCTTGATACCGTCGTGCTTCATGCTCCAGCA
TTTGACATTGAGCGCGCCCTGAGTTCGGCCCTAGAGGACGGAGCTGATGATCTCCCCTCTGTTCTCTCGTCAATC
CCCCAACGGTCTCTATTGTTCTTTGATGAATTTTTGCCTGTCCGTATCATCTTGAGACTATCTGATTGCTCAGAA
ACGACCTTGAAACACTACCTGCCACGACTCGAAGTCAAGCTCGATGTCTTTGCTGTCGATCCAGCAGAATCAGTT
GGCGAAAACCTCACGCCAACTCGCGATATAATATTCTCAGGAATTGTCGGTCGAGATGAGGATCCCCTAGTAGTC
TTCAATGAATTCGAAGGTGATGAAGGCAGTGGGAATCATGTCTATTTGGTTTGGAACATCGAGACTATACTGCGG
CGTCCCCGTATTCGAATCCAACATCCGTCACTCTTATTCATTGCGTCTGCCAGTCTGAATCCGGCTGACGCTCGC
CGTCGAGAGAATTCGGGGGATGACTATCTCCCCTCACTCGTCCCCGCATCGACCAATATGCTGCAATCTCTATCC
ACTGATAAATCTTTCAATCATAAAGAGCCTTTCCTCCCCGCTTCCAGACTATTGAGGGTTGTACCGACAACATAC
GACGAAGACCCGATTTACAATATCCAGCAACAACACGGTCACCCCTTTCGCGTTGTGCCAGCCGCAAGCGCAAGG
ATTCGATACTCTCGGTTAAGCTCCTACACGGCTATACCGATGACCGTGGCCAGTCTTGACTTTGAGGTCACCCCT
TATCTGGCTTGCGAGGTCTCCTTTGACAAAGCGAATCTTCACCTGTCCGAGGGAACGATTGAGTCGCTTTCAGAC
ACACCGGGCCTGGCTCTTCCTATTACTTGCCGTCCGCGAGACGATGTGACCCTCATGTATAAACTTACACCGGAG
TATGGCCCAGAGACCAATCCATCATCTACCGCGTTAGTCAGCACGCTGGACATATCTCTCGAGGCAGCAATTCTT
GTGGATGACGACTGCAAGCCACGTATTTCTATGCAGTGGAGAACCAACGTCGATTTCTCAGTCGCCCTAAATCCG
AATTTTGGGGGGCCCAGTCCAGCGCTGCAAAGGACCAACCGCCCTACCAGTCTATCGGTGTCAACCCAAGTGGGT
GTGAACCCTCATCGAAGCTCATTGCGAGAACGAGCATATTCGGTCACCGACGTGGGTATCACAATCTCATTCTCT
GGACCTGTTCGTGTGCAAGTGGGCTGTGTCTTCTCTTGGGATGTTTTTATTGTCAATCGATCAAACGCTCCTCGA
AAGTTTGCCTTGATCGCCATACCCAAGCGGAAAAGCGTGGACCCACGAGGCCATGTTGCTCGGCCTTCATCGTCA
TCTATCACCAGCCGGAAAGAGGACCAAGTGGCCGAGGCGGTAACTGACGATAATATCGTGCATGCGAGGCAAAAG
AGTGTGGCTGGTCAGGAAGTGGAACTGATCAGCTTGAGCACAGACATTCGCGTGGGCCCCCTCCTCCCAGGAACT
TGCCATTCGACTGAACTCAAACTCCTTCCCCTAGCTACAGGCCCACTTCATTTGGAGGCGGTCCGGCTTGTAGAT
GTGAACACGAACGAAACGACTGATATCCGAGATCTTCCGGACATTTTGGCGGATGATCAGCCTCGCTCTAGTTAA
Gene >Pro_DTO377G3_2|g4876.t1
ATGCCTGGTCTGGAGATCCCAGGTGAATTCTTGCGTCATGCAATTCTTGATACCGTCGTGCTTCATGCTCCAGCA
TTTGACATTGAGCGCGCCCTGAGTTCGGCCCTAGAGGACGGAGCTGATGATCTCCCCTCTGTTCTCTCGTCAATC
CCCCAACGGTCTCTATTGTTCTTTGGTATGCACTTTCAAAGGATCAGCAGAGTTTGCGCCTTACTCATTAATAGC
AATTAGATGAATTTTTGCCTGTCCGTATCATCTTGAGACTATCTGATTGCTCAGAAACGACCTTGAAACACTACC
TGCCACGACTCGAAGTCAAGCTCGATGTCTTTGCTGTCGATCCAGCAGAATCAGTTGGCGAAAACCTCACGCCAA
CTCGCGATATAATATTCTCAGGAATTGTCGGTCGAGATGAGGATCCCCTAGTAGTCTTCAATGAATTCGAAGGTG
ATGAAGGCAGTGGGAATCATGTCTATTTGGTTTGGAACATCGAGACTATACTGCGTGAGTGATTTGAATCTTTGG
ATTGACATGAACGTCACTAACTTGGTTGATAGGGCGTCCCCGTATTCGAATCCAACATCCGTCACTCTTATTCAT
TGCGTCTGCCAGTCTGAATCCGGCTGACGCTCGCCGTCGAGAGAATTCGGGGGATGACTATCTCCCCTCACTCGT
CCCCGCATCGACCAATATGCTGCAATCTCTATCCACTGATAAATCTTTCAATCATAAAGAGCCTTTCCTCCCCGC
TTCCAGACTATTGAGGGTTGTACCGACAACATACGACGAAGACCCGATTTACAATATCCAGCAACAACACGGTCA
CCCCTTTCGCGTTGTGCCAGCCGCAAGCGCAAGGATTCGATACTCTCGGTTAAGCTCCTACACGGCTATACCGAT
GACCGTGGCCAGTCTTGACTTTGAGGTCACCCCTTATCTGGCTTGCGAGGTCTCCTTTGACAAAGCGAATCTTCA
CCTGTCCGAGGGAACGATTGAGTCGCTTTCAGACACACCGGGCCTGGCTCTTCCTATTACTTGCCGTCCGCGAGA
CGATGTGACCCTCATGTATAAACTTACACCGGAGTATGGCCCAGAGACCAATCCATCATCTACCGCGTTAGTCAG
CACGCTGGACATATCTCTCGAGGCAGCAATTCTTGTGGATGACGACTGCAAGCCACGTATTTCTATGCAGTGGAG
AACCAACGTCGATTTCTCAGTCGCCCTAAATCCGAATTTTGGGGGGCCCAGTCCAGCGCTGCAAAGGACCAACCG
CCCTACCAGTCTATCGGTGTCAACCCAAGTGGGTGTGAACCCTCATCGAAGCTCATTGCGAGAACGAGCATATTC
GGTCACCGACGTGGGTATCACAATCTCATTCTCTGGACCTGTTCGTGTGCAAGTGGGCTGTGTCTTCTCTTGGGA
TGTTTTTATTGTCAATCGATCAAACGCTCCTCGAAAGTTTGCCTTGATCGCCATACCCAAGCGGAAAAGCGTGGA
CCCACGAGGCCATGTTGCTCGGCCTTCATCGTCATCTATCACCAGCCGGAAAGAGGACCAAGTGGCCGAGGCGGT
AACTGACGATAATATCGTGCATGCGAGGCAAAAGAGTGTGGCTGGTCAGGAAGTGGAACTGATCAGCTTGAGCAC
AGACATTCGCGTGGGGTGAGTATTCTCTACTGTGTTCCTTTTCGTTTCCTTCTCTAAGCTGACGTTTTATTAGCC
CCCTCCTCCCAGGAACTTGCCATTCGACTGAACTCAAACTCCTTCCCCTAGCTACAGGCCCACTTCATTTGGAGG
CGGTCCGGCTTGTAGATGTGAACACGAACGAAACGACTGATATCCGAGATCTTCCGGACATTTTGGCGGATGATC
AGCCTCGCTCTAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail