Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4863.t1
Gene name
Locationscaffold_10:575965..577065
Strand-
Gene length (bp)1100
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.0E-05 226 246

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.89 0.78 6.99
5d_25C Five days - 25 degrees Celsius 1.95 0.04 3.87
7d_25C Seven days - 25 degrees Celsius 1.49 0.00 3.03
10d_25C Ten days - 25 degrees Celsius 0.22 0.00 0.62
7d_15C Seven days - 15 degrees Celsius 0.74 0.00 1.90
7d_30C Seven days - 30 degrees Celsius 1.36 0.00 2.76

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.197390 no
3d_25C 7d_25C 0.056008 no
3d_25C 7d_15C 0.062802 no
3d_25C 7d_30C 0.039986 yes
3d_25C 10d_25C 0.049575 yes
5d_25C 7d_25C 0.708494 no
5d_25C 7d_15C 0.252265 no
5d_25C 7d_30C 0.604378 no
5d_25C 10d_25C 0.082612 no
7d_25C 7d_15C 0.404991 no
7d_25C 7d_30C 0.913943 no
7d_25C 10d_25C 0.108807 no
7d_15C 7d_30C 0.481507 no
7d_15C 10d_25C 0.305567 no
7d_30C 10d_25C 0.114216 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4863.t1
MLSTCYTTQRTNIFREPLYNFPASVTAYRGIGIEEMSTCRTSIVSILNNDDNPSFAVRSAPRLSRTHISSSQYPH
SERPPSPISDPQYTRPAASSQSPATSPRGSRHHSDAVTDVAQPASPGSSDGSAYDYLTSQPSSYHPYARQDPRRE
PYRFPARGPAAPRTSPETRSTTSETASQTGATRGTGRKNKYPCPYAASHGCSSTFTTSGHAARHGKKHTGEKSVH
CPICNKAFTRKDNMKQHIRTHRSHSDEMRSISESEPDARWAMARPDAVYASVSHQRNVSQPIEAGARPVPGSVPV
PGPQAP*
Coding >Pro_DTO377G3_2|g4863.t1
ATGTTGTCGACGTGTTACACGACACAGAGGACAAACATATTTCGAGAGCCGCTGTATAATTTCCCAGCCTCGGTG
ACCGCATATCGGGGCATTGGCATTGAGGAGATGTCCACTTGTAGGACGAGTATTGTGTCCATTCTGAATAATGAT
GATAACCCATCTTTTGCGGTCCGTTCCGCGCCCCGACTTAGTCGGACTCACATATCATCATCACAATATCCACAT
TCAGAGCGACCACCCTCTCCTATCAGCGACCCACAGTATACCCGCCCTGCAGCTTCATCCCAATCTCCAGCAACA
TCACCACGAGGGAGCAGGCATCATTCAGACGCGGTGACGGACGTCGCCCAGCCCGCTTCGCCCGGGTCGTCCGAT
GGCTCAGCTTACGACTATCTCACCAGTCAACCATCATCTTACCACCCGTATGCCCGGCAGGATCCGCGACGGGAA
CCATACCGATTCCCAGCTCGCGGGCCAGCAGCTCCCCGAACATCACCCGAGACTCGTTCAACCACATCCGAAACG
GCTTCTCAGACCGGAGCGACGCGCGGCACGGGGCGAAAGAACAAGTACCCGTGCCCCTATGCCGCGAGCCATGGG
TGCTCTTCCACATTTACGACTTCGGGCCATGCTGCGCGCCACGGCAAAAAGCACACCGGCGAAAAGAGCGTGCAC
TGTCCGATCTGCAACAAAGCCTTTACGAGGAAAGACAACATGAAACAGCACATCCGGACCCATCGCTCGCACTCG
GACGAGATGCGCTCTATTTCCGAGTCGGAGCCTGATGCTCGGTGGGCGATGGCTCGTCCTGACGCGGTATACGCC
TCCGTCTCGCACCAGCGCAATGTCAGTCAACCTATCGAGGCAGGTGCACGGCCGGTCCCAGGGTCTGTCCCAGTG
CCTGGTCCCCAGGCGCCCTAA
Transcript >Pro_DTO377G3_2|g4863.t1
ATGTTGTCGACGTGTTACACGACACAGAGGACAAACATATTTCGAGAGCCGCTGTATAATTTCCCAGCCTCGGTG
ACCGCATATCGGGGCATTGGCATTGAGGAGATGTCCACTTGTAGGACGAGTATTGTGTCCATTCTGAATAATGAT
GATAACCCATCTTTTGCGGTCCGTTCCGCGCCCCGACTTAGTCGGACTCACATATCATCATCACAATATCCACAT
TCAGAGCGACCACCCTCTCCTATCAGCGACCCACAGTATACCCGCCCTGCAGCTTCATCCCAATCTCCAGCAACA
TCACCACGAGGGAGCAGGCATCATTCAGACGCGGTGACGGACGTCGCCCAGCCCGCTTCGCCCGGGTCGTCCGAT
GGCTCAGCTTACGACTATCTCACCAGTCAACCATCATCTTACCACCCGTATGCCCGGCAGGATCCGCGACGGGAA
CCATACCGATTCCCAGCTCGCGGGCCAGCAGCTCCCCGAACATCACCCGAGACTCGTTCAACCACATCCGAAACG
GCTTCTCAGACCGGAGCGACGCGCGGCACGGGGCGAAAGAACAAGTACCCGTGCCCCTATGCCGCGAGCCATGGG
TGCTCTTCCACATTTACGACTTCGGGCCATGCTGCGCGCCACGGCAAAAAGCACACCGGCGAAAAGAGCGTGCAC
TGTCCGATCTGCAACAAAGCCTTTACGAGGAAAGACAACATGAAACAGCACATCCGGACCCATCGCTCGCACTCG
GACGAGATGCGCTCTATTTCCGAGTCGGAGCCTGATGCTCGGTGGGCGATGGCTCGTCCTGACGCGGTATACGCC
TCCGTCTCGCACCAGCGCAATGTCAGTCAACCTATCGAGGCAGGTGCACGGCCGGTCCCAGGGTCTGTCCCAGTG
CCTGGTCCCCAGGCGCCCTAA
Gene >Pro_DTO377G3_2|g4863.t1
ATGTTGTCGACGTGTTACACGACACAGAGGACAAACATATTTCGAGAGCCGCTGGTGCGTTTGTCGGGTCCTCCG
GGGGGGCAAGAAATGAGAGAGATATTCTTTCTCTTCTTCTACACCCTCTTCCCTTTCTCCCCTTGTCTCAGACCG
GCGATCTCTCGAGTTCTTGCGAGTTCCCAGAGCCCGGCTGAGCCGGTTGCCAACAGTCTAAACTAACTTCATTTT
GTCTCTAGTATAATTTCCCAGCCTCGGTGACCGCATATCGGGGCATTGGCATTGAGGAGATGTCCACTTGTAGGA
CGAGTATTGTGTCCATTCTGAATAATGATGATAACCCATCTTTTGCGGTCCGTTCCGCGCCCCGACTTAGTCGGA
CTCACATATCATCATCACAATATCCACATTCAGAGCGACCACCCTCTCCTATCAGCGACCCACAGTATACCCGCC
CTGCAGCTTCATCCCAATCTCCAGCAACATCACCACGAGGGAGCAGGCATCATTCAGACGCGGTGACGGACGTCG
CCCAGCCCGCTTCGCCCGGGTCGTCCGATGGCTCAGCTTACGACTATCTCACCAGTCAACCATCATCTTACCACC
CGTATGCCCGGCAGGATCCGCGACGGGAACCATACCGATTCCCAGCTCGCGGGCCAGCAGCTCCCCGAACATCAC
CCGAGACTCGTTCAACCACATCCGAAACGGCTTCTCAGACCGGAGCGACGCGCGGCACGGGGCGAAAGAACAAGT
ACCCGTGCCCCTATGCCGCGAGCCATGGGTGCTCTTCCACATTTACGACTTCGGGCCATGCTGCGCGCCACGGCA
AAAAGCACACCGGCGAAAAGAGCGTGCACTGTCCGATCTGCAACAAAGCCTTTACGAGGAAAGACAACATGAAAC
AGCACATCCGGACCCATCGCTCGCACTCGGACGAGATGCGCTCTATTTCCGAGTCGGAGCCTGATGCTCGGTGGG
CGATGGCTCGTCCTGACGCGGTATACGCCTCCGTCTCGCACCAGCGCAATGTCAGTCAACCTATCGAGGCAGGTG
CACGGCCGGTCCCAGGGTCTGTCCCAGTGCCTGGTCCCCAGGCGCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail