Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g486.t1
Gene name
Locationscaffold_01:1235524..1238868
Strand+
Gene length (bp)3344
Transcript length (bp)3102
Coding sequence length (bp)3102
Protein length (aa) 1034

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00899 ThiF ThiF family 2.0E-34 28 409
PF00899 ThiF ThiF family 1.2E-70 422 921
PF10585 UBA_e1_thiolCys Ubiquitin-activating enzyme active site 6.3E-96 611 861
PF09358 E1_UFD Ubiquitin fold domain 9.0E-31 937 1027
PF16190 E1_FCCH Ubiquitin-activating enzyme E1 FCCH domain 1.3E-28 202 271
PF16191 E1_4HB Ubiquitin-activating enzyme E1 four-helix bundle 5.5E-27 272 340

GO

GO Term Description Terminal node
GO:0008641 ubiquitin-like modifier activating enzyme activity Yes
GO:0016877 ligase activity, forming carbon-sulfur bonds No
GO:0016874 ligase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g486.t1
MTDIKMQVENPQETIEAIKHGEIDESLYSRQLYVLGHEAMKRMGSSNVLIVGLKGLGVEIAKNIALAGVKSLTLY
DPAAVAISDLSSQFFLQPEDVGKPRAEVTAPRVAELNSYVPVTVHEGQSLVGDLERLKHYQAVVLTQTPLKEQLV
IADFCHKNNIYLTITDTFGLFGYIFNDFGKNFTVGDPTGEEPAGGIVAAINEEGLVSALDETRHGLEDGDFVTFT
EVKGMDGLNNSDPRKVTVKGPYTFTIGDVSGLGSYEGGGLFAQVKMPKFIDFQPLEDQLKKPELLMSDYAKFDRP
QQLHIGIQALHKFAETHDGQLPHPHNDSDAQEVLKIANDLAATDEEKVELDEKIIKELSYQARGDLNPLAAFFGG
IAAQEVLKAVSGKFSPIHQWLYFDSLESLPSSVTRSEESCKPLGTRYDGQIAVFGKEYQDKLANVTEFLVGSGAI
GCETLKNWAMMGLGTGPKGKLYVTDMDQIEKSNLNRQFLFRTKDVGRLKSECASAAAQAMNRELKDKIVTLRDRV
GADTEHVFNEDFWNGLDGVTNALDNVDARTYVDRRCVFFRKPLLESGTLGTKCNTQVVLPFITESYSSSQDPPEK
SFPMCTLKSFPNRIEHTIAWARDVFQTYFVGPPESVNMYLSQPDYIQQTLKQAGNEKQTLEHLRDFLVTEKPLTF
DDCIVWARQQFEAQYNNAIQQLLYNFPRDSKTSSGQLFWSGPKRAPTPLKFDSTNPTHLGFVIAGANLHAFNYGI
KNPGADKDYYRRVVDDMIVPEFTPSSNVKIQANENDPDPNAQPAGLSNDEEEIQKLVASLPSPKSLAGFRLQPVE
FEKDDDTNHHIDFITAASNLRADNYEIPQADRHKTKFIAGKIIPAIATTTALATGLIGLELYKIVDGKDDIEQYK
NGFVNLALPFFSFSEPIGSEKGKYQGKQGEVTIDKLWDRFEVEDIQLQEFLDFFAEKGLDITMVSSGVSLLYASF
YPPSKVKDRLPLPMSKLVEHVSKKPVPEHQKNIIFEVTAEDQTEEDVEVPYVMVKLTK*
Coding >Pro_DTO377G3_2|g486.t1
ATGACGGACATTAAAATGCAGGTCGAGAACCCCCAAGAAACCATCGAAGCTATCAAGCATGGGGAGATCGACGAA
TCATTGTACAGTCGACAGCTATACGTTCTTGGTCACGAAGCCATGAAGCGCATGGGATCTTCCAATGTTCTGATT
GTAGGTCTCAAGGGCTTGGGCGTGGAAATCGCCAAGAACATCGCCCTCGCCGGTGTCAAATCCCTCACCCTATAC
GACCCCGCAGCAGTCGCTATCTCGGATCTTTCTTCGCAGTTTTTCCTTCAGCCAGAGGACGTCGGCAAGCCCCGT
GCTGAAGTTACCGCCCCGAGAGTCGCCGAGTTGAACTCCTACGTTCCCGTTACAGTCCATGAGGGCCAGAGCCTC
GTGGGCGATCTCGAACGACTAAAGCACTACCAGGCAGTGGTGCTCACACAGACACCTTTGAAGGAGCAACTGGTG
ATTGCTGACTTCTGCCACAAGAACAACATCTACCTTACAATTACAGACACATTCGGTCTCTTTGGTTATATCTTC
AATGACTTTGGAAAGAACTTCACTGTGGGTGATCCCACCGGTGAAGAGCCTGCTGGTGGAATTGTGGCGGCTATC
AATGAAGAAGGGTTGGTTTCGGCGCTCGATGAGACAAGGCATGGACTCGAGGATGGTGACTTTGTCACTTTCACT
GAAGTCAAGGGCATGGATGGCTTAAACAACAGTGATCCTCGCAAAGTTACTGTGAAAGGTCCCTATACTTTCACC
ATTGGTGACGTGTCTGGTCTAGGATCCTACGAGGGTGGTGGTCTATTCGCTCAGGTCAAGATGCCCAAGTTCATT
GATTTCCAGCCACTAGAGGATCAACTTAAAAAGCCCGAGCTTCTCATGTCCGACTATGCCAAGTTTGACCGGCCA
CAACAATTGCACATTGGTATCCAGGCTCTTCATAAGTTCGCGGAGACTCATGATGGCCAATTACCTCATCCCCAC
AATGATAGCGACGCCCAGGAGGTTCTGAAGATCGCTAACGATCTTGCTGCTACTGATGAGGAAAAAGTCGAACTG
GATGAGAAGATAATAAAGGAGCTGAGCTACCAGGCCCGCGGTGACCTGAACCCATTGGCAGCTTTCTTCGGTGGT
ATCGCCGCCCAGGAAGTTCTGAAGGCTGTCTCCGGCAAGTTCAGTCCTATTCATCAGTGGTTGTACTTTGACTCT
TTGGAGTCTTTGCCCTCATCAGTCACTCGATCTGAAGAAAGCTGCAAGCCTCTTGGTACCCGCTACGATGGGCAA
ATTGCGGTGTTTGGCAAGGAATACCAAGACAAACTTGCCAATGTCACCGAATTTTTGGTCGGTTCTGGTGCTATC
GGTTGTGAGACGCTGAAGAATTGGGCTATGATGGGTCTGGGTACGGGTCCGAAAGGAAAGCTTTACGTCACCGAC
ATGGACCAGATTGAGAAGAGCAATCTTAACCGGCAATTCCTCTTCCGTACCAAGGACGTCGGCAGACTCAAGAGT
GAATGCGCGTCTGCGGCCGCTCAAGCAATGAACCGAGAATTGAAAGACAAGATTGTCACTCTTCGTGATCGCGTC
GGTGCCGACACTGAACATGTATTCAATGAGGATTTCTGGAACGGCCTTGATGGTGTGACAAACGCTTTAGACAAC
GTCGATGCACGGACATATGTTGATCGCCGCTGTGTCTTCTTCCGCAAGCCATTGCTGGAGAGTGGTACCCTGGGC
ACCAAGTGTAACACTCAGGTCGTTCTTCCTTTCATCACGGAGTCCTACTCTAGCTCTCAGGATCCCCCGGAGAAG
TCATTCCCTATGTGTACTCTGAAGAGCTTCCCGAACCGCATTGAGCACACCATTGCATGGGCACGGGATGTCTTC
CAAACCTACTTCGTTGGTCCCCCTGAATCAGTCAACATGTACCTCTCTCAACCCGACTACATTCAGCAGACCCTC
AAGCAAGCGGGTAATGAGAAGCAAACCTTGGAGCACTTGCGTGACTTCTTGGTCACTGAAAAACCTCTAACTTTC
GATGATTGTATTGTGTGGGCTCGCCAACAATTTGAAGCGCAGTACAATAACGCGATCCAGCAGCTTCTCTACAAC
TTCCCCCGAGATTCCAAGACATCATCCGGTCAACTATTCTGGTCTGGACCTAAGCGCGCCCCTACACCCTTGAAG
TTCGACAGCACTAATCCAACTCATCTTGGATTTGTTATTGCCGGTGCTAACCTCCATGCGTTCAACTACGGCATC
AAGAACCCCGGTGCGGACAAGGACTATTACCGCAGGGTAGTTGATGACATGATTGTTCCCGAGTTCACTCCCAGC
TCGAATGTCAAGATTCAGGCCAATGAAAACGACCCTGATCCGAATGCGCAGCCAGCTGGTTTGTCCAATGACGAG
GAGGAAATCCAGAAATTGGTCGCATCTCTTCCCTCGCCCAAGTCTCTTGCTGGTTTCCGCTTGCAGCCAGTTGAG
TTTGAGAAGGATGATGACACCAATCACCACATCGACTTCATCACCGCGGCTAGCAACCTCCGTGCAGACAACTAC
GAGATCCCTCAGGCGGACCGACACAAGACCAAATTTATCGCTGGAAAGATCATCCCGGCGATTGCCACAACTACT
GCCCTAGCCACCGGTCTTATTGGCCTCGAACTGTACAAGATTGTTGACGGCAAGGACGACATCGAGCAGTACAAG
AACGGCTTTGTTAATTTGGCCCTTCCGTTCTTTAGCTTCAGTGAGCCGATTGGTAGCGAAAAGGGCAAGTATCAA
GGCAAGCAAGGCGAGGTCACAATTGACAAGCTCTGGGACCGATTCGAGGTGGAAGACATCCAGCTTCAGGAGTTC
CTCGACTTCTTCGCCGAGAAGGGTTTGGACATCACCATGGTCAGCTCTGGAGTCAGCTTGTTGTATGCAAGCTTC
TATCCCCCATCGAAGGTCAAGGATCGCCTTCCTCTACCTATGAGCAAGCTTGTGGAGCACGTCAGTAAGAAGCCA
GTCCCCGAGCATCAGAAGAATATAATCTTCGAGGTGACCGCCGAGGACCAGACAGAAGAGGATGTCGAGGTTCCC
TACGTGATGGTCAAGCTCACAAAATAA
Transcript >Pro_DTO377G3_2|g486.t1
ATGACGGACATTAAAATGCAGGTCGAGAACCCCCAAGAAACCATCGAAGCTATCAAGCATGGGGAGATCGACGAA
TCATTGTACAGTCGACAGCTATACGTTCTTGGTCACGAAGCCATGAAGCGCATGGGATCTTCCAATGTTCTGATT
GTAGGTCTCAAGGGCTTGGGCGTGGAAATCGCCAAGAACATCGCCCTCGCCGGTGTCAAATCCCTCACCCTATAC
GACCCCGCAGCAGTCGCTATCTCGGATCTTTCTTCGCAGTTTTTCCTTCAGCCAGAGGACGTCGGCAAGCCCCGT
GCTGAAGTTACCGCCCCGAGAGTCGCCGAGTTGAACTCCTACGTTCCCGTTACAGTCCATGAGGGCCAGAGCCTC
GTGGGCGATCTCGAACGACTAAAGCACTACCAGGCAGTGGTGCTCACACAGACACCTTTGAAGGAGCAACTGGTG
ATTGCTGACTTCTGCCACAAGAACAACATCTACCTTACAATTACAGACACATTCGGTCTCTTTGGTTATATCTTC
AATGACTTTGGAAAGAACTTCACTGTGGGTGATCCCACCGGTGAAGAGCCTGCTGGTGGAATTGTGGCGGCTATC
AATGAAGAAGGGTTGGTTTCGGCGCTCGATGAGACAAGGCATGGACTCGAGGATGGTGACTTTGTCACTTTCACT
GAAGTCAAGGGCATGGATGGCTTAAACAACAGTGATCCTCGCAAAGTTACTGTGAAAGGTCCCTATACTTTCACC
ATTGGTGACGTGTCTGGTCTAGGATCCTACGAGGGTGGTGGTCTATTCGCTCAGGTCAAGATGCCCAAGTTCATT
GATTTCCAGCCACTAGAGGATCAACTTAAAAAGCCCGAGCTTCTCATGTCCGACTATGCCAAGTTTGACCGGCCA
CAACAATTGCACATTGGTATCCAGGCTCTTCATAAGTTCGCGGAGACTCATGATGGCCAATTACCTCATCCCCAC
AATGATAGCGACGCCCAGGAGGTTCTGAAGATCGCTAACGATCTTGCTGCTACTGATGAGGAAAAAGTCGAACTG
GATGAGAAGATAATAAAGGAGCTGAGCTACCAGGCCCGCGGTGACCTGAACCCATTGGCAGCTTTCTTCGGTGGT
ATCGCCGCCCAGGAAGTTCTGAAGGCTGTCTCCGGCAAGTTCAGTCCTATTCATCAGTGGTTGTACTTTGACTCT
TTGGAGTCTTTGCCCTCATCAGTCACTCGATCTGAAGAAAGCTGCAAGCCTCTTGGTACCCGCTACGATGGGCAA
ATTGCGGTGTTTGGCAAGGAATACCAAGACAAACTTGCCAATGTCACCGAATTTTTGGTCGGTTCTGGTGCTATC
GGTTGTGAGACGCTGAAGAATTGGGCTATGATGGGTCTGGGTACGGGTCCGAAAGGAAAGCTTTACGTCACCGAC
ATGGACCAGATTGAGAAGAGCAATCTTAACCGGCAATTCCTCTTCCGTACCAAGGACGTCGGCAGACTCAAGAGT
GAATGCGCGTCTGCGGCCGCTCAAGCAATGAACCGAGAATTGAAAGACAAGATTGTCACTCTTCGTGATCGCGTC
GGTGCCGACACTGAACATGTATTCAATGAGGATTTCTGGAACGGCCTTGATGGTGTGACAAACGCTTTAGACAAC
GTCGATGCACGGACATATGTTGATCGCCGCTGTGTCTTCTTCCGCAAGCCATTGCTGGAGAGTGGTACCCTGGGC
ACCAAGTGTAACACTCAGGTCGTTCTTCCTTTCATCACGGAGTCCTACTCTAGCTCTCAGGATCCCCCGGAGAAG
TCATTCCCTATGTGTACTCTGAAGAGCTTCCCGAACCGCATTGAGCACACCATTGCATGGGCACGGGATGTCTTC
CAAACCTACTTCGTTGGTCCCCCTGAATCAGTCAACATGTACCTCTCTCAACCCGACTACATTCAGCAGACCCTC
AAGCAAGCGGGTAATGAGAAGCAAACCTTGGAGCACTTGCGTGACTTCTTGGTCACTGAAAAACCTCTAACTTTC
GATGATTGTATTGTGTGGGCTCGCCAACAATTTGAAGCGCAGTACAATAACGCGATCCAGCAGCTTCTCTACAAC
TTCCCCCGAGATTCCAAGACATCATCCGGTCAACTATTCTGGTCTGGACCTAAGCGCGCCCCTACACCCTTGAAG
TTCGACAGCACTAATCCAACTCATCTTGGATTTGTTATTGCCGGTGCTAACCTCCATGCGTTCAACTACGGCATC
AAGAACCCCGGTGCGGACAAGGACTATTACCGCAGGGTAGTTGATGACATGATTGTTCCCGAGTTCACTCCCAGC
TCGAATGTCAAGATTCAGGCCAATGAAAACGACCCTGATCCGAATGCGCAGCCAGCTGGTTTGTCCAATGACGAG
GAGGAAATCCAGAAATTGGTCGCATCTCTTCCCTCGCCCAAGTCTCTTGCTGGTTTCCGCTTGCAGCCAGTTGAG
TTTGAGAAGGATGATGACACCAATCACCACATCGACTTCATCACCGCGGCTAGCAACCTCCGTGCAGACAACTAC
GAGATCCCTCAGGCGGACCGACACAAGACCAAATTTATCGCTGGAAAGATCATCCCGGCGATTGCCACAACTACT
GCCCTAGCCACCGGTCTTATTGGCCTCGAACTGTACAAGATTGTTGACGGCAAGGACGACATCGAGCAGTACAAG
AACGGCTTTGTTAATTTGGCCCTTCCGTTCTTTAGCTTCAGTGAGCCGATTGGTAGCGAAAAGGGCAAGTATCAA
GGCAAGCAAGGCGAGGTCACAATTGACAAGCTCTGGGACCGATTCGAGGTGGAAGACATCCAGCTTCAGGAGTTC
CTCGACTTCTTCGCCGAGAAGGGTTTGGACATCACCATGGTCAGCTCTGGAGTCAGCTTGTTGTATGCAAGCTTC
TATCCCCCATCGAAGGTCAAGGATCGCCTTCCTCTACCTATGAGCAAGCTTGTGGAGCACGTCAGTAAGAAGCCA
GTCCCCGAGCATCAGAAGAATATAATCTTCGAGGTGACCGCCGAGGACCAGACAGAAGAGGATGTCGAGGTTCCC
TACGTGATGGTCAAGCTCACAAAATAA
Gene >Pro_DTO377G3_2|g486.t1
ATGACGGTATGATTAGTCTTGATCTTAGAGATAAGATTGCCACTAATATATCTTACCAAAGGACATTAAAATGCA
GGTCGAGAACCCCCAAGAAACCATCGAAGCTATCAAGCATGGGGAGATCGACGAATCATTGTACAGTCGACAGCT
GTAAGCCCCCCGCATCCCTCTTATGACATACAGATCCCGAGTATGTGCTGACACCTTAGAGATACGTTCTTGGTC
ACGAAGCCATGAAGCGCATGGGATCTTCCAATGTTCTGATTGTAGGTCTCAAGGGCTTGGGCGTGGAAATCGGTA
TGTGATTCAACTATTAATCAAGCCTCGATTTCATCCCGACGTCTGATTGTCTCCATAGCCAAGAACATCGCCCTC
GCCGGTGTCAAATCCCTCACCCTATACGACCCCGCAGCAGTCGCTATCTCGGATCTTTCTTCGCAGTTTTTCCTT
CAGCCAGAGGACGTCGGCAAGCCCCGTGCTGAAGTTACCGCCCCGAGAGTCGCCGAGTTGAACTCCTACGTTCCC
GTTACAGTCCATGAGGGCCAGAGCCTCGTGGGCGATCTCGAACGACTAAAGCACTACCAGGCAGTGGTGCTCACA
CAGACACCTTTGAAGGAGCAACTGGTGATTGCTGACTTCTGCCACAAGAACAACATCTACCTTACAATTACAGAC
ACATTCGGTCTCTTTGGTTATATCTTCAATGACTTTGGAAAGAACTTCACTGTGGGTGATCCCACCGGTGAAGAG
CCTGCTGGTGGAATTGTGGCGGCTATCAATGAAGAAGGGTTGGTTTCGGCGCTCGATGAGACAAGGCATGGACTC
GAGGATGGTGACTTTGTCACTTTCACTGAAGTCAAGGGCATGGATGGCTTAAACAACAGTGATCCTCGCAAAGTT
ACTGTGAAAGGTCCCTATACTTTCACCATTGGTGACGTGTCTGGTCTAGGATCCTACGAGGGTGGTGGTCTATTC
GCTCAGGTCAAGATGCCCAAGTTCATTGATTTCCAGCCACTAGAGGATCAACTTAAAAAGCCCGAGCTTCTCATG
TCCGACTATGCCAAGTTTGACCGGCCACAACAATTGCACATTGGTATCCAGGCTCTTCATAAGTTCGCGGAGACT
CATGATGGCCAATTACCTCATCCCCACAATGATAGCGACGCCCAGGAGGTTCTGAAGATCGCTAACGATCTTGCT
GCTACTGATGAGGAAAAAGTCGAACTGGATGAGAAGATAATAAAGGAGCTGAGCTACCAGGCCCGCGGTGACCTG
AACCCATTGGCAGCTTTCTTCGGTGGTATCGCCGCCCAGGAAGTTCTGAAGGCTGTCTCCGGCAAGTTCAGTCCT
ATTCATCAGTGGTTGTACTTTGACTCTTTGGAGTCTTTGCCCTCATCAGTCACTCGATCTGAAGAAAGCTGCAAG
CCTCTTGGTACCCGCTACGATGGGCAAATTGCGGTGTTTGGCAAGGAATACCAAGACAAACTTGCCAATGTCACC
GAATTTTTGGTCGGTTCTGGTGCTATCGGTTGTGAGACGCTGAAGAATTGGGCTATGATGGGTCTGGGTACGGGT
CCGAAAGGAAAGCTTTACGTCACCGACATGGACCAGATTGAGAAGAGCAATCTTAACCGGCAATTCCTCTTCCGT
ACCAAGGACGTCGGCAGACTCAAGAGTGAATGCGCGTCTGCGGCCGCTCAAGCAATGAACCGAGAATTGAAAGAC
AAGATTGTCACTCTTCGTGATCGCGTCGGTGCCGACACTGAACATGTATTCAATGAGGATTTCTGGAACGGCCTT
GATGGTGTGACAAACGCTTTAGACAACGTCGATGCACGGACATATGTTGATCGCCGCTGTGTCTTCTTCCGCAAG
CCATTGCTGGAGAGTGGTACCCTGGGCACCAAGTGTAACACTCAGGTCGTTCTTCCTTTCATCACGGAGTCCTAC
TCTAGCTCTCAGGATCCCCCGGAGAAGTCATTCCCTATGTGTACTCTGAAGAGCTTCCCGAACCGCATTGAGCAC
ACCATTGCATGGGCACGGGATGTCTTCCAAACCTACTTCGTTGGTCCCCCTGAATCAGTCAACATGTACCTCTCT
CAACCCGACTACATTCAGCAGACCCTCAAGCAAGCGGGTAATGAGAAGCAAACCTTGGAGCACTTGCGTGACTTC
TTGGTCACTGAAAAACCTCTAACTTTCGATGATTGTATTGTGTGGGCTCGCCAACAATTTGAAGCGCAGTACAAT
AACGCGATCCAGCAGCTTCTCTACAACTTCCCCCGAGATTCCAAGACATCATCCGGTCAACTATTCTGGTCTGGA
CCTAAGCGCGCCCCTACACCCTTGAAGTTCGACAGCACTAATCCAACTCATCTTGGATTTGTTATTGCCGGTGCT
AACCTCCATGCGTTCAACTACGGCATCAAGAACCCCGGTGCGGACAAGGACTATTACCGCAGGGTAGTTGATGAC
ATGATTGTTCCCGAGTTCACTCCCAGCTCGAATGTCAAGATTCAGGCCAATGAAAACGACCCTGATCCGAATGCG
CAGCCAGCTGGTTTGTCCAATGACGAGGAGGAAATCCAGAAATTGGTCGCATCTCTTCCCTCGCCCAAGTCTCTT
GCTGGTTTCCGCTTGCAGCCAGTTGAGTTTGAGAAGGATGATGACACCAATCACCACATCGACTTCATCACCGCG
GCTAGCAACCTCCGTGCAGACAACTACGAGATCCCTCAGGCGGACCGACACAAGACCAAATTTATCGCTGGAAAG
ATCATCCCGGCGATTGCCACAACTACTGCCCTAGCCACCGGTCTTATTGGCCTCGAACTGTACAAGATTGTTGAC
GGCAAGGACGACATCGAGCAGTACAAGAACGGCTTTGTTAATTTGGCCCTTCCGTTCTTTAGCTTCAGTGAGCCG
ATTGGTAGCGAAAAGGGCAAGTATCAAGGCAAGCAAGGCGAGGTCACAATTGACAAGCTCTGGGACCGATTCGAG
GTGGAAGACATCCAGCTTCAGGAGTTCCTCGACTTCTTCGCCGAGAAGGGTTTGGACATCACCATGGTCAGCTCT
GGAGTCAGCTTGTTGTATGCAAGCTTCTATCCCCCATCGAAGGTCAAGGATCGCCTTCCTCTACCGTGAGTATCT
TCTCTTCTATAGCTACCCCATGCGTGAGTTAGATTACTGACATTGTACCTTGCAGTATGAGCAAGCTTGTGGAGC
ACGTCAGTAAGAAGCCAGTCCCCGAGCATCAGAAGAATATAATCTTCGAGGTGACCGCCGAGGACCAGACAGAAG
AGGATGTCGAGGTTCCCTACGTGATGGTCAAGCTCACAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail