Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4849.t1
Gene name
Locationscaffold_10:550673..551111
Strand-
Gene length (bp)438
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.0E-25 7 122
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.4E-19 15 122
PF08659 KR KR domain 5.0E-08 9 123

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 42.18 16.46 67.91
5d_25C Five days - 25 degrees Celsius 29.80 10.29 49.31
7d_25C Seven days - 25 degrees Celsius 18.64 5.09 32.19
10d_25C Ten days - 25 degrees Celsius 13.19 2.86 23.52
7d_15C Seven days - 15 degrees Celsius 38.41 13.78 63.05
7d_30C Seven days - 30 degrees Celsius 32.05 11.29 52.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.361407 no
3d_25C 7d_25C 0.028409 yes
3d_25C 7d_15C 0.850726 no
3d_25C 7d_30C 0.498471 no
3d_25C 10d_25C 0.004840 yes
5d_25C 7d_25C 0.252883 no
5d_25C 7d_15C 0.557316 no
5d_25C 7d_30C 0.887361 no
5d_25C 10d_25C 0.042216 yes
7d_25C 7d_15C 0.058988 no
7d_25C 7d_30C 0.173101 no
7d_25C 10d_25C 0.491134 no
7d_15C 7d_30C 0.695568 no
7d_15C 10d_25C 0.009770 yes
7d_30C 10d_25C 0.027278 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4849.t1
MAALTGKVAIITGGSNGIGKATALRLARDGAKVVIQYRSNEQSAQEVVSQIGEQNALAIKGNASCVLNSEELIRR
TVEKFGQIDIVIANAGSLPLHDLANTSEQDFNDSIDLNVKGPYFLVQVRHADCRQPTCRRYKKKFFAADG*
Coding >Pro_DTO377G3_2|g4849.t1
ATGGCTGCTCTCACTGGAAAGGTTGCCATAATCACCGGTGGCTCTAATGGTATTGGCAAGGCGACAGCTCTTCGT
CTTGCGCGCGATGGTGCCAAGGTGGTTATCCAGTATCGCTCCAATGAGCAAAGCGCCCAGGAGGTGGTGAGCCAA
ATTGGAGAGCAGAACGCCCTGGCTATCAAGGGAAATGCCAGTTGTGTGCTCAACAGCGAGGAGCTGATCCGTCGT
ACAGTGGAGAAGTTTGGTCAAATTGACATTGTCATTGCCAACGCCGGTTCCTTGCCCCTCCATGACCTGGCAAAC
ACCTCGGAGCAAGACTTCAACGACAGTATTGATCTGAATGTGAAGGGACCCTACTTTTTGGTTCAGGTACGACAT
GCAGATTGCAGACAACCCACCTGCAGAAGATACAAAAAAAAGTTCTTTGCTGCTGATGGTTGA
Transcript >Pro_DTO377G3_2|g4849.t1
ATGGCTGCTCTCACTGGAAAGGTTGCCATAATCACCGGTGGCTCTAATGGTATTGGCAAGGCGACAGCTCTTCGT
CTTGCGCGCGATGGTGCCAAGGTGGTTATCCAGTATCGCTCCAATGAGCAAAGCGCCCAGGAGGTGGTGAGCCAA
ATTGGAGAGCAGAACGCCCTGGCTATCAAGGGAAATGCCAGTTGTGTGCTCAACAGCGAGGAGCTGATCCGTCGT
ACAGTGGAGAAGTTTGGTCAAATTGACATTGTCATTGCCAACGCCGGTTCCTTGCCCCTCCATGACCTGGCAAAC
ACCTCGGAGCAAGACTTCAACGACAGTATTGATCTGAATGTGAAGGGACCCTACTTTTTGGTTCAGGTACGACAT
GCAGATTGCAGACAACCCACCTGCAGAAGATACAAAAAAAAGTTCTTTGCTGCTGATGGTTGA
Gene >Pro_DTO377G3_2|g4849.t1
ATGGCTGCTCTCACTGGAAAGGTTGCCATAATCACCGGTGGCTCTAATGGTATTGGCAAGGCGACAGCTCTTCGT
CTTGCGCGCGATGGTGCCAAGGTGGTTATCCAGTATCGCTCCAATGAGCAAAGCGCCCAGGAGGTGGTGAGCCAA
ATTGGAGAGCAGAACGCCCTGGCTATCAAGGGAAATGCCAGTTGTGTGCTCAACAGCGAGGAGCTGATCCGTCGT
ACAGTGGAGAAGTTTGGTCAAATTGACATTGTCATTGCCAACGCCGGTTCCTTGCCCCTCCATGACCTGGCAAAC
ACCTCGGAGCAAGACTTCAACGACAGTATTGATCTGAATGTGAAGGGACCCTACTTTTTGGTTCAGGTACGACAT
GCAGATTGCAGACAACCCACCTGCAGAAGATACAAAAAAAAGTTCTTTGCTGCTGATGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail