Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4836.t1
Gene name
Locationscaffold_10:517152..518387
Strand+
Gene length (bp)1235
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 5.4E-13 10 91
PF00153 Mito_carr Mitochondrial carrier protein 3.3E-07 126 211
PF00153 Mito_carr Mitochondrial carrier protein 3.4E-18 243 351

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 62 84 22
3 240 262 22
4 324 343 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 187.44 114.26 260.61
5d_25C Five days - 25 degrees Celsius 306.49 182.31 430.67
7d_25C Seven days - 25 degrees Celsius 298.38 176.49 420.28
10d_25C Ten days - 25 degrees Celsius 359.23 212.48 505.97
7d_15C Seven days - 15 degrees Celsius 375.49 211.30 539.68
7d_30C Seven days - 30 degrees Celsius 214.00 126.67 301.32

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.019353 yes
3d_25C 7d_25C 0.023429 yes
3d_25C 7d_15C 0.001278 yes
3d_25C 7d_30C 0.631348 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.938593 no
5d_25C 7d_15C 0.445139 no
5d_25C 7d_30C 0.108148 no
5d_25C 10d_25C 0.560247 no
7d_25C 7d_15C 0.368719 no
7d_25C 7d_30C 0.138887 no
7d_25C 10d_25C 0.471925 no
7d_15C 7d_30C 0.006371 yes
7d_15C 10d_25C 0.899576 no
7d_30C 10d_25C 0.011688 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4836.t1
MYNTHSDIWVAGAFAALIVDFIAYPFDTLKTRVQSPDYEKVFKNARTGAVRRNVLFRGLYQGVWSVVFTTIPASG
AFFTTYEAVKSIMYNSSKEASTSMNGGKRSSPDGSLNSLRLPFTHSLPTPIMNAIASSAGEMVSCLIITPAEVLK
QNAQMVQGSHADKSAMRQVIWRFQHHPWRLWSGYTALLARNLPNTALQFPLFEYVRSHLINRRRRLKATRMNTGQ
PPSEIKDQLVERAGLTGIAAAISGTIAATVTTPIDVIKTRLMLSASDAASSQHKSTQAGTRGNEAISSDVRKKTK
PGKTLISVGRDIIRYEGVRGLFKGGLIRAGWTAIALGLYLSLYEGARFYLENRRKEREHVS*
Coding >Pro_DTO377G3_2|g4836.t1
ATGTACAACACTCATTCCGATATTTGGGTCGCAGGCGCATTTGCCGCACTCATAGTCGATTTTATCGCCTACCCC
TTCGACACACTCAAGACCCGTGTCCAATCCCCAGACTATGAGAAGGTCTTCAAGAATGCGCGCACAGGAGCAGTG
CGGCGCAATGTACTCTTCCGAGGATTATACCAAGGTGTTTGGAGTGTGGTCTTCACAACAATTCCAGCTTCTGGC
GCATTCTTTACCACATACGAAGCTGTGAAGAGCATTATGTACAATTCCTCAAAAGAAGCATCCACGAGCATGAAC
GGTGGCAAGAGAAGCTCACCCGATGGCTCTTTGAACAGTCTTCGCTTGCCCTTCACACATTCCCTCCCTACTCCA
ATTATGAATGCAATTGCCTCTTCGGCCGGCGAGATGGTATCATGCCTCATTATCACGCCCGCGGAGGTACTGAAA
CAAAACGCACAGATGGTTCAAGGCTCCCATGCGGACAAATCCGCCATGCGACAAGTAATCTGGCGATTCCAACAT
CATCCTTGGCGCCTATGGAGTGGGTATACGGCACTGCTTGCTCGGAACCTCCCAAACACAGCTTTACAATTTCCA
CTCTTTGAGTATGTACGATCACACCTGATTAACCGACGAAGACGATTGAAAGCGACTCGGATGAACACTGGTCAA
CCACCATCGGAAATCAAGGATCAACTAGTCGAACGGGCCGGCTTGACGGGTATAGCTGCGGCAATTTCAGGCACG
ATCGCGGCGACAGTTACTACTCCAATTGACGTTATCAAGACTCGACTGATGCTTTCGGCAAGTGATGCTGCTAGT
TCCCAACATAAAAGTACTCAGGCTGGTACTCGGGGCAATGAGGCGATATCTTCGGATGTGCGGAAAAAAACTAAA
CCTGGCAAGACTCTCATTTCTGTCGGTCGTGATATCATACGATATGAGGGTGTCCGTGGTTTGTTCAAGGGCGGA
CTGATACGGGCTGGTTGGACGGCGATTGCACTAGGCCTTTATCTCAGCCTGTATGAAGGAGCCCGGTTTTATCTA
GAGAATCGACGGAAGGAGCGCGAGCATGTCAGTTAG
Transcript >Pro_DTO377G3_2|g4836.t1
ATGTACAACACTCATTCCGATATTTGGGTCGCAGGCGCATTTGCCGCACTCATAGTCGATTTTATCGCCTACCCC
TTCGACACACTCAAGACCCGTGTCCAATCCCCAGACTATGAGAAGGTCTTCAAGAATGCGCGCACAGGAGCAGTG
CGGCGCAATGTACTCTTCCGAGGATTATACCAAGGTGTTTGGAGTGTGGTCTTCACAACAATTCCAGCTTCTGGC
GCATTCTTTACCACATACGAAGCTGTGAAGAGCATTATGTACAATTCCTCAAAAGAAGCATCCACGAGCATGAAC
GGTGGCAAGAGAAGCTCACCCGATGGCTCTTTGAACAGTCTTCGCTTGCCCTTCACACATTCCCTCCCTACTCCA
ATTATGAATGCAATTGCCTCTTCGGCCGGCGAGATGGTATCATGCCTCATTATCACGCCCGCGGAGGTACTGAAA
CAAAACGCACAGATGGTTCAAGGCTCCCATGCGGACAAATCCGCCATGCGACAAGTAATCTGGCGATTCCAACAT
CATCCTTGGCGCCTATGGAGTGGGTATACGGCACTGCTTGCTCGGAACCTCCCAAACACAGCTTTACAATTTCCA
CTCTTTGAGTATGTACGATCACACCTGATTAACCGACGAAGACGATTGAAAGCGACTCGGATGAACACTGGTCAA
CCACCATCGGAAATCAAGGATCAACTAGTCGAACGGGCCGGCTTGACGGGTATAGCTGCGGCAATTTCAGGCACG
ATCGCGGCGACAGTTACTACTCCAATTGACGTTATCAAGACTCGACTGATGCTTTCGGCAAGTGATGCTGCTAGT
TCCCAACATAAAAGTACTCAGGCTGGTACTCGGGGCAATGAGGCGATATCTTCGGATGTGCGGAAAAAAACTAAA
CCTGGCAAGACTCTCATTTCTGTCGGTCGTGATATCATACGATATGAGGGTGTCCGTGGTTTGTTCAAGGGCGGA
CTGATACGGGCTGGTTGGACGGCGATTGCACTAGGCCTTTATCTCAGCCTGTATGAAGGAGCCCGGTTTTATCTA
GAGAATCGACGGAAGGAGCGCGAGCATGTCAGTTAG
Gene >Pro_DTO377G3_2|g4836.t1
ATGTACAACACTCATTCCGATATTTGGGTCGTGAGTCTCACCCGATCAAAGCATCTCCAGTATACTTTCCTATTC
TCACCACTAACTGGTCATATTCCTCAATAGGCAGGCGCATTTGCCGCACTCATAGTCGATTTTATCGCCTACCCC
TTCGACACACTCAAGACCCGTGTCCAATCCCCAGACTATGAGAAGGTCTTCAAGAATGCGCGCACAGGAGCAGTG
CGGCGCAATGTACTCTTCCGAGGATTATACCAAGGTGTTTGGAGTGTGGTCTTCACAACAATTCCAGCTTGTATG
TGTTGGCTCTTGTTGATGAACAGGGAACTAGGAATATCACCACTAACGATCCTATCAACGACAATCTAGCTGGCG
CATTCTTTACCACATACGAAGCTGTGAAGAGCATTATGTACAATTCCTCAAAAGAAGCATCCACGAGCATGAACG
GTGGCAAGAGAAGCTCACCCGATGGCTCTTTGAACAGTCTTCGCTTGCCCTTCACACATTCCCTCCCTACTCCAA
TTATGAATGCAATTGCCTCTTCGGCCGGCGAGATGGTATCATGCCTCATTATCACGCCCGCGGAGGTACTGAAAC
AAAACGCACAGATGGTTCAAGGCTCCCATGCGGACAAATCCGCCATGCGACAAGTAATCTGGCGATTCCAACATC
ATCCTTGGCGCCTATGGAGTGGGTATACGGCACTGCTTGCTCGGAACCTCCCAAACACAGCTTTACAATTTCCAC
TCTTTGAGTATGTACGATCACACCTGATTAACCGACGAAGACGATTGAAAGCGACTCGGATGAACACTGGTCAAC
CACCATCGGAAATCAAGGATCAACTAGTCGAACGGGCCGGCTTGACGGGTATAGCTGCGGCAATTTCAGGCACGA
TCGCGGCGACAGTTACTACTCCAATTGACGTTATCAAGACTCGACTGATGCTTTCGGCAAGTGATGCTGCTAGTT
CCCAACATAAAAGTACTCAGGCTGGTACTCGGGGCAATGAGGCGATATCTTCGGATGTGCGGAAAAAAACTAAAC
CTGGCAAGACTCTCATTTCTGTCGGTCGTGATATCATACGATATGAGGGTGTCCGTGGTTTGTTCAAGGGCGGAC
TGATACGGGCTGGTTGGACGGCGATTGCACTAGGCCTTTATCTCAGCCTGTATGAAGGAGCCCGGTTTTATCTAG
AGAATCGACGGAAGGAGCGCGAGCATGTCAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail