Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4830.t1
Gene name
Locationscaffold_10:508065..509309
Strand+
Gene length (bp)1244
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01214 CK_II_beta Casein kinase II regulatory subunit 1.4E-74 147 323

GO

GO Term Description Terminal node
GO:0005956 protein kinase CK2 complex Yes
GO:0019887 protein kinase regulator activity Yes
GO:0019207 kinase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0140535 intracellular protein-containing complex No
GO:0098772 molecular function regulator activity No
GO:0032991 protein-containing complex No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 41 63 22
3 133 150 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4830.t1
MVSWLSPQVVLFFVVFLGGAASALFQRASWYADHGDMDSCFLCVSFAITSVYFYVHLLCIYVQISLEVDLARFDP
NDPNGPRGSPGSDFNPGGQNKPPSGQSPQPSRRGPARGGSSTSSRFSDSPLSSYRSRAVLFMIMLIAIMYLQFVS
SRGNEYFCEIDEDYLTDRFNLTGLNTEVPYYQYALDLVTDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRG
LAKMLEKYKKSDFGKCPRVMCDGHALLPLGESDLPNASTVKLYCPKCEDIYNPKSSRHSSIDGAYFGTSFHSILF
QVYPALNPEKSSRRYEPRIYGFKVHAAAALARYQDNQREDLKWRLAEVDINHRFIEDSESDDDAFEYDEDYVEGH
VEQVKNDKLFGDAASLA*
Coding >Pro_DTO377G3_2|g4830.t1
ATGGTGTCTTGGCTGTCTCCACAAGTTGTCCTTTTCTTCGTGGTCTTCTTGGGCGGCGCAGCATCTGCGCTGTTC
CAACGCGCGTCTTGGTACGCGGACCATGGCGATATGGATTCTTGTTTCTTGTGTGTATCGTTCGCGATCACTTCG
GTCTACTTTTACGTCCATTTGCTCTGCATTTACGTCCAGATATCATTGGAAGTTGATCTAGCCAGGTTTGATCCA
AATGACCCCAATGGTCCCCGCGGCTCTCCTGGCTCGGATTTTAACCCCGGTGGACAAAATAAACCACCCAGTGGC
CAGTCACCCCAACCTTCACGGCGTGGCCCTGCGCGTGGAGGGTCTTCCACGTCCTCGCGTTTCTCCGATTCCCCT
CTGTCTAGTTACAGAAGCCGTGCAGTCTTATTCATGATTATGCTAATCGCAATCATGTATTTGCAGTTTGTCTCA
TCCCGTGGTAACGAATACTTCTGCGAGATTGACGAGGACTACCTAACCGATCGGTTCAACCTCACCGGTTTGAAC
ACCGAAGTTCCGTACTATCAGTACGCCCTTGATCTTGTGACCGACGTTTTCGATCTTGATGCCGACGACGATCTG
CGTGAGCAAATTGAAAAGTCTGCCCGTCACCTCTATGGCTTGGTTCATGCCCGGTACATTGTTACCACTCGTGGT
CTTGCCAAAATGCTTGAAAAGTACAAGAAGAGCGACTTCGGAAAGTGCCCACGCGTGATGTGTGATGGGCATGCT
TTGCTTCCTCTTGGCGAGTCCGATCTTCCGAATGCCAGCACCGTCAAGCTGTACTGCCCCAAGTGCGAAGACATC
TACAACCCGAAGTCGTCACGTCACTCGTCCATCGATGGTGCGTACTTCGGTACCTCGTTCCACTCCATTCTTTTC
CAGGTCTATCCGGCCCTCAATCCCGAGAAGAGCAGCCGTCGTTATGAACCCCGGATCTACGGCTTCAAGGTGCAC
GCCGCAGCTGCACTTGCTCGATACCAAGACAACCAGCGTGAGGATCTCAAGTGGCGTCTCGCCGAGGTCGATATC
AACCACAGGTTCATCGAGGATAGCGAGAGTGATGACGATGCATTCGAGTACGACGAAGATTATGTTGAAGGCCAC
GTGGAGCAAGTCAAGAACGACAAGCTCTTCGGTGATGCAGCTTCGCTCGCATGA
Transcript >Pro_DTO377G3_2|g4830.t1
ATGGTGTCTTGGCTGTCTCCACAAGTTGTCCTTTTCTTCGTGGTCTTCTTGGGCGGCGCAGCATCTGCGCTGTTC
CAACGCGCGTCTTGGTACGCGGACCATGGCGATATGGATTCTTGTTTCTTGTGTGTATCGTTCGCGATCACTTCG
GTCTACTTTTACGTCCATTTGCTCTGCATTTACGTCCAGATATCATTGGAAGTTGATCTAGCCAGGTTTGATCCA
AATGACCCCAATGGTCCCCGCGGCTCTCCTGGCTCGGATTTTAACCCCGGTGGACAAAATAAACCACCCAGTGGC
CAGTCACCCCAACCTTCACGGCGTGGCCCTGCGCGTGGAGGGTCTTCCACGTCCTCGCGTTTCTCCGATTCCCCT
CTGTCTAGTTACAGAAGCCGTGCAGTCTTATTCATGATTATGCTAATCGCAATCATGTATTTGCAGTTTGTCTCA
TCCCGTGGTAACGAATACTTCTGCGAGATTGACGAGGACTACCTAACCGATCGGTTCAACCTCACCGGTTTGAAC
ACCGAAGTTCCGTACTATCAGTACGCCCTTGATCTTGTGACCGACGTTTTCGATCTTGATGCCGACGACGATCTG
CGTGAGCAAATTGAAAAGTCTGCCCGTCACCTCTATGGCTTGGTTCATGCCCGGTACATTGTTACCACTCGTGGT
CTTGCCAAAATGCTTGAAAAGTACAAGAAGAGCGACTTCGGAAAGTGCCCACGCGTGATGTGTGATGGGCATGCT
TTGCTTCCTCTTGGCGAGTCCGATCTTCCGAATGCCAGCACCGTCAAGCTGTACTGCCCCAAGTGCGAAGACATC
TACAACCCGAAGTCGTCACGTCACTCGTCCATCGATGGTGCGTACTTCGGTACCTCGTTCCACTCCATTCTTTTC
CAGGTCTATCCGGCCCTCAATCCCGAGAAGAGCAGCCGTCGTTATGAACCCCGGATCTACGGCTTCAAGGTGCAC
GCCGCAGCTGCACTTGCTCGATACCAAGACAACCAGCGTGAGGATCTCAAGTGGCGTCTCGCCGAGGTCGATATC
AACCACAGGTTCATCGAGGATAGCGAGAGTGATGACGATGCATTCGAGTACGACGAAGATTATGTTGAAGGCCAC
GTGGAGCAAGTCAAGAACGACAAGCTCTTCGGTGATGCAGCTTCGCTCGCATGA
Gene >Pro_DTO377G3_2|g4830.t1
ATGGTGTCTTGGCTGTCTCCACAAGTTGTCCTTTTCTTCGTGGTCTTCTTGGGCGGCGCAGCATCTGCGCTGTTC
CAACGCGCGTCTTGGTACGCGGACCATGGCGATATGGATTCTTGTTTCTTGTGTGTATCGTTCGCGATCACTTCG
GTCTACTTTTACGTCCATTTGCTCTGCATTTACGTCCAGATATCATTGGAAGTTGATCTAGCCAGGTTTGATCCA
AATGACCCCAATGGTCCCCGCGGCTCTCCTGGCTCGGATTTTAACCCCGGTGGACAAAATAAACCACCCAGTGGC
CAGTCACCCCAACCTTCACGGCGTGGCCCTGCGCGTGGAGGGTCTTCCACGTCCTCGCGTTTCTCCGATTCCCCT
CTGTCTAGTTACAGAAGCCGTGCAGTCTTATTCATGATTATGCTAATCGCAATCATGTATTTGCAGTTTGTCTCA
TCCCGTGGTAACGAATACTTCTGCGAGATTGACGAGGACTACCTAACCGATCGGTTCAACCTCACCGGTTTGAAC
ACCGAAGTTCCGTACTATCAGTACGCCCTTGATCTTGTGACCGACGTTTTCGATCTTGATGCCGACGACGATCTG
CGTGAGCAAATTGAAAAGTCTGCCCGTCACCTCTATGGCTTGGTTCATGCCCGGTACATTGTTACCACTCGTGGT
CTTGCCAAAATGGTATGTTGAAATTCGGAACTTGTGTGCATGTTGTTTCCCAGACGAAAGTACTAACCTCCGTGC
AGCTTGAAAAGTACAAGAAGAGCGACTTCGGAAAGTGCCCACGCGTGATGTGTGATGGGCATGCTTTGCTTCCTC
TTGGCGAGTCCGATCTTCCGAATGCCAGCACCGTCAAGCTGTACTGCCCCAAGTGCGAAGACATCTACAACCCGA
AGTCGTCACGTCACTCGTCCATCGATGGTGCGTACTTCGGTACCTCGTTCCACTCCATTCTTTTCCAGGTCTATC
CGGCCCTCAATCCCGAGAAGAGCAGCCGTCGTTATGAACCCCGGATCTACGGCTTCAAGGTGCACGCCGCAGCTG
CACTTGCTCGATACCAAGACAACCAGCGTGAGGATCTCAAGTGGCGTCTCGCCGAGGTCGATATCAACCACAGGT
TCATCGAGGATAGCGAGAGTGATGACGATGCATTCGAGTACGACGAAGATTATGTTGAAGGCCACGTGGAGCAAG
TCAAGAACGACAAGCTCTTCGGTGATGCAGCTTCGCTCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail