Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4829.t1
Gene name
Locationscaffold_10:505502..507114
Strand+
Gene length (bp)1612
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6 3.2E-106 61 358

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0030245 cellulose catabolic process Yes
GO:0016052 carbohydrate catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0003824 catalytic activity No
GO:0005976 polysaccharide metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0051275 beta-glucan catabolic process No
GO:0051273 beta-glucan metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0000272 polysaccharide catabolic process No
GO:0044248 cellular catabolic process No
GO:0044264 cellular polysaccharide metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0005975 carbohydrate metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0030243 cellulose metabolic process No
GO:0044275 cellular carbohydrate catabolic process No
GO:0008152 metabolic process No
GO:0044247 cellular polysaccharide catabolic process No
GO:0016787 hydrolase activity No
GO:0009251 glucan catabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006073 cellular glucan metabolic process No
GO:0044237 cellular metabolic process No
GO:0044042 glucan metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4829.t1
MQFLLLPFVPLLASSAAAAAISSAASPAVTAAASGNPFSGYQPYANSYYASEVSSSALPSMTGAAKAAASAAAQV
PSFFWLDTADKVPTMGEFLADIRAKNNAGASPPIAGQFVVYDLPDRDCAALASNGEYSIANGGVANYKAYIDSIR
NVLVEYSDIQTILVIEPDGLANLVTNMAVSKCANAHDAYLECTNYAVTQLNLANVAMYLDAGHAGWLGWPANLSP
AAELFANVYNTANKPAALRGLATNVANYNAWSLSTCPSYTSGDANCDEKKYVNALAPLLKNGGWEAHFITDTGRN
GVQPTQQNAWGDWCNVKGTGFGVRPTTETGDALTDAFVWVKPGGESDGTSDSSSARYDAYCGYSDALQPAPEAGT
WFQAYFAQLVENANPSL*
Coding >Pro_DTO377G3_2|g4829.t1
ATGCAATTTCTTCTTCTTCCATTCGTACCTCTGCTGGCTTCTTCCGCAGCGGCAGCTGCAATATCCAGCGCAGCT
AGTCCAGCTGTCACCGCTGCAGCTTCTGGAAATCCCTTCTCAGGGTACCAGCCTTATGCCAATTCGTATTATGCA
TCAGAAGTCTCATCCTCAGCCTTGCCATCAATGACGGGGGCTGCCAAAGCCGCCGCAAGTGCAGCCGCTCAAGTT
CCGTCCTTTTTCTGGCTGGATACTGCAGACAAGGTACCAACAATGGGCGAGTTCTTGGCCGACATCAGGGCCAAA
AACAACGCCGGTGCTAGCCCACCGATTGCTGGCCAATTCGTCGTTTACGACCTGCCTGATCGTGACTGCGCAGCA
TTGGCTAGCAATGGAGAGTACTCTATCGCGAACGGTGGTGTTGCGAATTACAAGGCGTACATTGACTCTATCCGC
AATGTGTTGGTCGAATACTCTGATATCCAGACTATCCTTGTCATTGAGCCTGATGGTCTGGCTAATTTGGTTACC
AACATGGCTGTGTCGAAGTGTGCCAACGCACATGACGCATACTTGGAGTGCACCAATTATGCCGTCACACAATTG
AACTTGGCCAATGTTGCCATGTATCTTGACGCTGGACACGCGGGATGGCTTGGCTGGCCTGCTAATCTGAGCCCA
GCAGCTGAGCTCTTCGCCAACGTCTACAACACTGCCAATAAACCTGCAGCTCTGCGCGGACTTGCCACCAACGTT
GCCAATTACAATGCCTGGTCTCTCTCTACATGCCCATCATACACCTCTGGCGATGCCAACTGCGATGAAAAGAAA
TACGTCAATGCCCTTGCGCCCCTGCTTAAGAATGGAGGTTGGGAAGCCCACTTCATCACTGACACCGGCCGCAAT
GGAGTCCAGCCCACCCAGCAAAATGCATGGGGTGATTGGTGCAATGTCAAGGGAACCGGATTCGGTGTTCGACCA
ACCACGGAGACAGGTGATGCCTTGACCGATGCCTTTGTTTGGGTGAAGCCCGGTGGTGAGAGCGATGGTACTTCG
GATTCCAGCTCGGCTCGCTATGATGCCTACTGTGGGTATAGCGATGCTCTTCAGCCTGCTCCTGAAGCTGGCACG
TGGTTCCAGGCATACTTCGCCCAGCTTGTAGAGAATGCTAACCCGTCTCTTTAA
Transcript >Pro_DTO377G3_2|g4829.t1
ATGCAATTTCTTCTTCTTCCATTCGTACCTCTGCTGGCTTCTTCCGCAGCGGCAGCTGCAATATCCAGCGCAGCT
AGTCCAGCTGTCACCGCTGCAGCTTCTGGAAATCCCTTCTCAGGGTACCAGCCTTATGCCAATTCGTATTATGCA
TCAGAAGTCTCATCCTCAGCCTTGCCATCAATGACGGGGGCTGCCAAAGCCGCCGCAAGTGCAGCCGCTCAAGTT
CCGTCCTTTTTCTGGCTGGATACTGCAGACAAGGTACCAACAATGGGCGAGTTCTTGGCCGACATCAGGGCCAAA
AACAACGCCGGTGCTAGCCCACCGATTGCTGGCCAATTCGTCGTTTACGACCTGCCTGATCGTGACTGCGCAGCA
TTGGCTAGCAATGGAGAGTACTCTATCGCGAACGGTGGTGTTGCGAATTACAAGGCGTACATTGACTCTATCCGC
AATGTGTTGGTCGAATACTCTGATATCCAGACTATCCTTGTCATTGAGCCTGATGGTCTGGCTAATTTGGTTACC
AACATGGCTGTGTCGAAGTGTGCCAACGCACATGACGCATACTTGGAGTGCACCAATTATGCCGTCACACAATTG
AACTTGGCCAATGTTGCCATGTATCTTGACGCTGGACACGCGGGATGGCTTGGCTGGCCTGCTAATCTGAGCCCA
GCAGCTGAGCTCTTCGCCAACGTCTACAACACTGCCAATAAACCTGCAGCTCTGCGCGGACTTGCCACCAACGTT
GCCAATTACAATGCCTGGTCTCTCTCTACATGCCCATCATACACCTCTGGCGATGCCAACTGCGATGAAAAGAAA
TACGTCAATGCCCTTGCGCCCCTGCTTAAGAATGGAGGTTGGGAAGCCCACTTCATCACTGACACCGGCCGCAAT
GGAGTCCAGCCCACCCAGCAAAATGCATGGGGTGATTGGTGCAATGTCAAGGGAACCGGATTCGGTGTTCGACCA
ACCACGGAGACAGGTGATGCCTTGACCGATGCCTTTGTTTGGGTGAAGCCCGGTGGTGAGAGCGATGGTACTTCG
GATTCCAGCTCGGCTCGCTATGATGCCTACTGTGGGTATAGCGATGCTCTTCAGCCTGCTCCTGAAGCTGGCACG
TGGTTCCAGGCATACTTCGCCCAGCTTGTAGAGAATGCTAACCCGTCTCTTTAA
Gene >Pro_DTO377G3_2|g4829.t1
ATGCAATTTCTTCTTCTTCCATTCGTACCTCTGCTGGCTTCTTCCGCAGCGGCAGCTGCAATATCCAGCGCAGCT
AGTCCAGCTGTCACCGCTGCAGCTTCTGGAAATCCCTTCTCAGGGTACCAGCCTTATGCCAATTCGTATTATGCA
TCAGAAGTCTCATCCTCAGCCTTGCCATCAATGACGGGGGCTGCCAAAGCCGCCGCAAGTGCAGCCGCTCAAGTT
CCGTCCTTTTTCTGGCTGTGAGTTCATTGCACTGGTATTATATATCCCTCGGGCAAATACTCAGATTGCCTTATA
GGGATACTGCAGACAAGGTACCAACAATGGGCGAGTTCTTGGCCGACATCAGGGCCAAAAACAACGCCGGTGCTA
GCCCACCGATTGCTGGCCAATTCGTCGTTTACGACCTGCCTGATCGTGACTGCGCAGCATTGGCTAGCAATGGAG
AGTACTCTATCGCGAACGGTGGTGTTGCGAATTACAAGGCGTACATTGACTCTATCCGCAATGTGTTGGTCGAAT
ACTCTGATATCCAGACTATCCTTGTCATTGGTGAGTATACCTTGCTGATTGATGGCTTCCCGCACGGCAATAGTG
ATTGCTGATATTTTTTCTAGAGCCTGATGGTCTGGCTAATTTGGTTACCAACATGGCTGTGTCGAAGTGTGCCAA
CGCACATGACGCATACTTGGAGTGCACCAATTATGCCGTCACACAATTGAACTTGGCCAATGTTGCCATGTATCT
TGACGCTGGTAAGCATCTTTCCTCGGTCCTGGAAGGCGACAATCCCCTTGCGACAAGTAAAACAGCGAGAATTAT
CTTTATTTCTGTTTAGCCAACCGCTCAGTTATGTCATTTTATGTGGCGTCATGAGAATAATGCAGCCATCTCTCA
TCTGTATATGCTTACTATTAACATAGGACACGCGGGATGGCTTGGCTGGCCTGCTAATCTGAGCCCAGCAGCTGA
GCTCTTCGCCAACGTCTACAACACTGCCAATAAACCTGCAGCTCTGCGCGGACTTGCCACCAACGTTGCCAATTA
CAATGCCTGGTCTCTCTCTACATGCCCATCATACACCTCTGGCGATGCCAACTGCGATGAAAAGAAATACGTCAA
TGCCCTTGCGCCCCTGCTTAAGAATGGAGGTTGGGAAGCCCACTTCATCACTGACACCGGTATGTAATCAAGAAA
CTTTAAAACAGCATCAGATCAATCACCTTCTTCTATGGGTCAAAGATCTCACGCTGAATGTTTTGGTACAGGCCG
CAATGGAGTCCAGCCCACCCAGCAAAATGCATGGGGTGATTGGTGCAATGTCAAGGGAACCGGATTCGGTGTTCG
ACCAACCACGGAGACAGGTGATGCCTTGACCGATGCCTTTGTTTGGGTGAAGCCCGGTGGTGAGAGCGATGGTAC
TTCGGATTCCAGCTCGGCTCGCTATGATGCCTACTGTGGGTATAGCGATGCTCTTCAGCCTGCTCCTGAAGCTGG
CACGTGGTTCCAGGTAAGAGTGCCCCGATTGAAAGTGATTATTTCTACAACACTGACGACTTCGCAGGCATACTT
CGCCCAGCTTGTAGAGAATGCTAACCCGTCTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail