Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4806.t1
Gene name
Locationscaffold_10:445195..452758
Strand+
Gene length (bp)7563
Transcript length (bp)7278
Coding sequence length (bp)7278
Protein length (aa) 2426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 1.6E-16 100 350
PF08323 Glyco_transf_5 Starch synthase catalytic domain 6.3E-15 1167 1370

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 1076 1098 22
2 2000 2022 22
3 2035 2052 17
4 2057 2079 22
5 2089 2111 22
6 2124 2146 22
7 2172 2194 22
8 2215 2234 19
9 2249 2271 22
10 2278 2300 22
11 2324 2346 22
12 2353 2375 22
13 2395 2417 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4806.t1
MKWLLTSGLVSLLAKTVTAWPYDEAYLDYNLNENKTATNPADYWGTWPGHEGKYHPSPTNWRFPFYSLFLDRFVN
GDPTNDNANGTTFEHDIEQRIRHGGDVAGLVETLDYLQGMGIKGLYIAGTSLLNQPWTSDGYGVLDTTILDAHYG
TIQTWRDAITEIHKRGMYVLFDNTIATMGDLIGFEGHLNTSTPFSEKEYRTQWKTERQYRDFTIGAGDYNQTCDY
PRFWFEDGYPVNESETSGLVGCYNSDFDQYGDIEAFGVWPDWKRQLAKFASVQDRLREWNPTVRERLIRHSCMII
QSLDIDGFRYDKGTQATVDALGDMSAAYRECARAVGKENFFITGEITGGNDFGAIYLGRGRQRNQWPESSAETIK
LTNESSAQWFLREAGHEAIDSAAFHYTTYRALTRFLGMDGQLSAGYDAPDDWVLGWDWMVQSNDLVNANTGKFDP
RHMFGVTNQDVFRWPSIANGTHRQLLGSFVTTLMLPGIPLLLWGEEQNFYILDATAENYIYGRQAMSPATAWRTH
GCFNLQSSQYYKWPVLAAKKGCEDVTVAYDHRDPSHPLRNIMKQMYHLREQYPILNDGFYIGNLSKKTDYVYYPG
SNGTATETGMWSIYRDINTNAQKYESKYQPVWLVYQNLNDTRTYTFDCNSDNVTKTLTAPFDSGTTVKNLFYPYD
EIKLVDGVRKLGLNGSTELNGCAESLKMKAYEFRAYVPIAKHQYPRPMITKFTPGHDFPLRSTVAPNLPENVTVE
LYFSEEMDCTSVTGAITIDSSTETGKVPTLDSDTVKCTTISPLLQTNWTAEIPSVWKWTANLTGVYNGIHKLTVT
NVTNKDTSSYTYAVDHFLFRVGQFDNPMVFTSANYSSSLLHKKDNGDLFIQHHAAGADKYRYSTNWASSFSNWKE
YKGGNDTIERLPWSGTKKQEWDGEHVRVEYWSRLTGSSDYVQQGDADWDHPVTRRFPHAFFNGPYNQYGFDGGLD
NRITLDTKTGVWSYHFTSEWPAVGQLNIWGINPDGKPDQTWVLGDIDNDTVLDRSPPSALSATLINITAAPAKGY
LSHKIYFDDGTLHFWLDPVGPQSTQIAMFVLFWIIPFLTAVGCVYIFMKSFYKVKFNQVGVSEKQNIPLAIWNKI
KTSSGHRDQSSNPLMRLANKSGFMQSTTALGGALASGKRRMVLIATMEYDIEDWAIKIKIGGLGVMAQLMGKTLG
HQDLIWVVPCVGGVDYPVDQEAEPMEVTILGSPYQVQVQYHVLNNITYVLLDAPVFRQQSKSEPYPARMDDLDSA
VYYSAWNQCIAEAIKRFPIDTYHINDYHGSLAPLYLLPRTIPVCLSLHNAEFQGLWPMRTLKEREEVCSVFNLNE
EVARRYVQFGEVFNLLHAGASYLRVHQSGFGAVGVSKKYGKRSYARYPIFWGLHKIGNLPNPDPSDVGEWTKEPT
KEQDITVDATYEAGRGELKRQAQEWAGLDQNPDADLLVFVGRWSMQKGVDLIADAMPAVIEARPNVQLICIGPVI
DLYGKFAALKLDHMMKVYPGRVFSKPEFTALPPFIFSGAEFALIPSRDEPFGLVAVEFGRKGALGIGARVGGLGQ
MPGWWYNVESISTSHLLMQFKLAIEAALNSKTSVRAMMRARSAKQRFPVAQWVEDLEILQSTAIAVHNKVAKGNN
NNNRPGTSSGVSTFSGALSPSPSMTQLGSPLASPGLNSPYTHSRDSSYSFNQMNNLAPQKKVSYSADTNLDDMEK
PKSGLSRSLSLGVHSGPGHAGRRRAAKEAGISESDENGATDAEGEDSSDEDTARTVFGDDEYTLTPAQVEAGRRA
QAAQRDRPQNLPSPSQESLHPRFMLPLESPGSPGTPPSADSLLLPPQPFGQSNRFSSASVLSLDSVVGNKTDFKL
QKVDPFFTDSTGEYYRTFDKKLDALNGSNSESQLCIEEFLVKSEQQWFDRFRNARLGRTKSPTPSIRHSSRNTDT
PDNMFYSDDLVSNINSNEENHLQDDEFLLGKDYVPPSGLKKWMQIKIGDWPVYSIFLALGQIIAANSYQITLLTG
EVGQTADKLYGIATTYAIASMCWWLVYRYFKSVVCLSTPWFLYAFAFLLIGSAHWQDDSFSRGWIQNVGTGFYAA
ASASGSIFFASNFGDEGGAPVETWIFRACVIQGIQQAYVIALWYWGSTMTKASSEGLLSAESGIANSWKMSAICY
PITVFLCFVGILLALGLPNYYRQKPGKVPSFYKSLFRRKIVAWNFVAVILQNFFLSAPYGRNWSFLWGSSHAHAW
QIVILCIVFFGVIWCIFLFVVSKFSKRHSWFLPVFACGLGAPRFIQIWWAISGIGYYLPWAGSYTSGALVSRSLW
LWLGVLDSIQGLGFGIILLQTLTRVHMCFALIASQVLGSIATICARAFGPNSVGPGPISPDMTKGAHSLANGWFW
VALFCQLLICAGFLLFFRKEQLAKP*
Coding >Pro_DTO377G3_2|g4806.t1
ATGAAGTGGCTACTCACCAGCGGATTGGTCTCGCTTCTTGCGAAAACCGTCACAGCTTGGCCATACGACGAGGCC
TACCTAGATTATAACCTCAATGAGAATAAGACGGCCACCAACCCAGCAGATTACTGGGGAACATGGCCTGGCCAT
GAGGGGAAATATCACCCCTCTCCAACAAATTGGCGCTTCCCGTTCTACTCTCTCTTCTTGGATCGCTTCGTGAAT
GGTGATCCTACCAATGACAACGCAAACGGTACCACGTTTGAGCATGATATTGAACAACGCATCCGCCATGGTGGC
GATGTGGCTGGCCTCGTCGAAACATTGGATTATCTCCAAGGAATGGGGATCAAGGGTCTCTATATTGCCGGAACC
TCCTTGCTGAATCAGCCGTGGACTTCAGACGGATATGGAGTTTTGGATACAACGATTCTCGACGCGCATTATGGA
ACTATCCAGACTTGGAGAGACGCCATCACCGAAATACACAAGCGCGGGATGTATGTCTTGTTCGACAATACTATT
GCGACAATGGGTGACTTGATTGGATTTGAAGGCCATCTAAACACATCTACTCCATTCTCGGAGAAGGAATATAGA
ACACAATGGAAGACTGAACGCCAATACAGAGACTTCACCATTGGAGCTGGCGACTACAATCAGACCTGTGACTAC
CCTCGATTCTGGTTCGAAGATGGATACCCCGTGAACGAATCAGAGACCTCAGGCTTGGTTGGATGTTACAACAGC
GACTTCGATCAGTACGGCGATATTGAGGCTTTCGGTGTGTGGCCTGATTGGAAGCGACAACTGGCCAAGTTCGCC
TCCGTCCAGGATCGTCTCCGCGAGTGGAACCCGACTGTGCGCGAAAGGTTGATCCGGCACTCCTGCATGATCATT
CAATCTTTAGATATTGATGGTTTCCGTTATGACAAGGGCACACAAGCTACCGTGGATGCTCTTGGAGACATGTCC
GCTGCCTACCGAGAATGTGCGCGCGCAGTTGGAAAAGAGAACTTCTTTATCACTGGCGAAATCACAGGTGGAAAC
GACTTTGGTGCCATTTACCTCGGAAGGGGTAGGCAGCGTAACCAGTGGCCTGAGAGCTCTGCCGAAACAATAAAG
TTGACAAATGAGTCCTCTGCCCAGTGGTTCTTACGCGAAGCGGGACATGAAGCCATCGATAGTGCAGCCTTCCAC
TATACGACATATCGTGCCCTGACTCGATTCCTTGGCATGGATGGGCAGCTTTCAGCCGGTTATGATGCGCCCGAT
GACTGGGTTTTGGGCTGGGACTGGATGGTGCAATCAAATGATTTGGTCAATGCTAACACCGGCAAGTTCGACCCT
CGACACATGTTTGGTGTGACGAATCAAGACGTCTTCCGTTGGCCATCGATTGCCAATGGTACACATCGGCAGTTG
CTCGGTTCTTTCGTGACTACATTGATGCTCCCCGGAATCCCACTTCTTCTTTGGGGCGAAGAGCAGAACTTCTAT
ATCTTAGATGCCACTGCGGAGAATTACATCTATGGGCGACAGGCAATGTCGCCTGCAACCGCGTGGAGAACTCAT
GGCTGCTTTAACCTGCAGTCCTCGCAGTACTACAAGTGGCCTGTTCTGGCAGCTAAAAAGGGCTGTGAGGATGTG
ACAGTTGCCTACGACCACCGCGACCCTTCCCACCCTCTTCGAAATATCATGAAGCAGATGTATCACTTGCGTGAA
CAGTACCCAATTCTCAATGACGGGTTTTACATTGGGAATTTGTCAAAGAAAACCGACTACGTTTACTACCCTGGT
TCCAATGGAACGGCCACGGAGACCGGAATGTGGTCCATTTACCGGGATATCAATACCAATGCGCAAAAATACGAA
TCCAAATATCAACCGGTCTGGCTTGTTTACCAAAACCTCAATGACACAAGGACATACACATTCGACTGCAACTCC
GACAATGTGACTAAGACACTGACTGCTCCATTCGATTCTGGTACCACTGTCAAGAACCTTTTCTACCCGTACGAC
GAGATCAAACTGGTGGATGGAGTGCGCAAACTCGGCTTGAATGGGTCCACGGAGTTGAATGGCTGTGCGGAAAGC
TTGAAAATGAAGGCATACGAGTTCCGTGCATACGTTCCTATCGCTAAACATCAATACCCTCGGCCCATGATCACC
AAATTCACCCCCGGCCATGATTTCCCACTGCGTTCTACTGTGGCGCCCAACCTTCCAGAGAATGTGACGGTTGAG
CTTTACTTCTCGGAAGAAATGGACTGTACCTCGGTGACCGGGGCAATTACCATCGATTCATCTACAGAGACTGGG
AAGGTTCCAACCCTAGATTCCGATACTGTGAAGTGCACAACTATCTCTCCCTTGCTCCAAACAAATTGGACTGCT
GAGATCCCAAGCGTTTGGAAGTGGACAGCAAACCTCACTGGAGTGTACAACGGAATCCATAAATTGACTGTCACC
AATGTTACCAACAAAGACACAAGCTCTTATACCTACGCTGTTGATCACTTCCTCTTCCGTGTCGGCCAGTTCGAT
AACCCTATGGTGTTCACTTCCGCCAACTACTCGAGCAGTCTACTCCACAAGAAGGACAACGGCGACCTCTTTATC
CAGCATCATGCTGCTGGTGCAGACAAATACCGTTATTCAACTAATTGGGCATCGTCATTCTCCAACTGGAAAGAA
TATAAAGGCGGAAATGATACCATCGAGAGGCTCCCATGGTCAGGAACCAAGAAACAAGAATGGGACGGTGAGCAT
GTGCGTGTTGAGTACTGGAGTCGTTTGACTGGAAGTAGCGACTACGTGCAGCAAGGTGACGCTGACTGGGACCAC
CCAGTCACACGACGTTTCCCCCATGCCTTCTTCAATGGACCCTACAACCAGTATGGATTCGACGGGGGCCTTGAC
AACAGAATCACACTCGACACCAAAACCGGAGTCTGGTCCTACCATTTCACGTCCGAATGGCCTGCAGTCGGTCAG
CTAAATATCTGGGGAATTAACCCAGACGGAAAGCCCGATCAAACCTGGGTTTTGGGTGATATCGACAATGACACA
GTCCTAGACCGAAGCCCACCGTCTGCTCTGAGCGCGACTTTGATCAATATCACCGCCGCGCCAGCGAAAGGCTAC
CTCTCTCACAAAATCTACTTCGACGATGGAACTCTCCATTTCTGGCTCGATCCGGTTGGACCTCAGTCCACACAG
ATTGCCATGTTCGTGTTATTCTGGATCATACCATTCCTCACTGCCGTGGGATGTGTGTACATCTTCATGAAGTCT
TTCTATAAGGTCAAATTCAACCAGGTCGGTGTGAGTGAGAAGCAAAACATTCCGCTCGCAATTTGGAACAAGATC
AAGACGTCCAGTGGTCACAGGGATCAATCCTCAAACCCACTAATGCGCTTAGCCAACAAATCCGGCTTCATGCAA
AGCACCACCGCTCTGGGCGGAGCTCTTGCTTCTGGCAAGCGACGCATGGTTCTAATCGCCACCATGGAGTACGAC
ATTGAGGATTGGGCCATCAAAATCAAAATCGGTGGTCTTGGTGTTATGGCTCAACTAATGGGTAAGACCCTAGGT
CACCAAGATCTCATCTGGGTCGTTCCTTGCGTTGGAGGTGTCGACTACCCTGTGGACCAAGAGGCAGAGCCTATG
GAAGTTACCATTCTCGGCAGCCCCTACCAGGTCCAAGTCCAATACCACGTCTTGAATAACATCACCTACGTCCTG
CTTGATGCTCCAGTGTTCCGTCAACAGTCAAAGTCCGAACCCTACCCTGCTCGTATGGATGATCTTGACAGTGCA
GTGTACTATTCAGCATGGAACCAGTGTATCGCGGAAGCCATCAAGCGATTCCCGATTGATACCTACCATATTAAC
GACTACCACGGTTCTCTCGCACCTCTTTACTTGCTCCCAAGAACTATCCCTGTTTGTCTCTCCTTGCACAATGCT
GAGTTCCAGGGTCTCTGGCCTATGCGAACTCTCAAGGAAAGAGAGGAGGTTTGCTCGGTCTTTAACCTTAACGAA
GAGGTCGCTCGTCGTTACGTGCAATTTGGTGAAGTGTTCAACTTACTCCACGCTGGCGCAAGCTATCTTCGTGTT
CACCAGTCAGGATTTGGTGCCGTCGGTGTTTCTAAGAAGTATGGTAAACGGTCCTATGCTCGCTATCCTATCTTC
TGGGGGTTGCATAAGATCGGCAATCTGCCTAACCCTGATCCATCTGACGTCGGTGAGTGGACAAAAGAGCCAACC
AAAGAGCAAGATATCACCGTTGATGCAACATACGAGGCTGGCCGTGGTGAGCTCAAGAGGCAGGCCCAGGAATGG
GCAGGACTCGATCAGAATCCTGATGCCGATCTACTTGTCTTTGTTGGTCGCTGGTCTATGCAAAAAGGTGTTGAT
CTCATTGCGGACGCAATGCCCGCTGTTATCGAAGCCCGGCCTAACGTGCAGCTGATCTGTATTGGCCCCGTTATC
GATCTCTACGGTAAATTCGCTGCTCTTAAGCTTGACCACATGATGAAAGTCTATCCCGGACGAGTCTTCTCAAAG
CCTGAATTCACTGCACTTCCGCCATTCATCTTCTCTGGGGCTGAGTTCGCCTTGATCCCATCTCGTGACGAGCCC
TTCGGTCTGGTTGCCGTCGAGTTTGGCCGAAAAGGTGCATTGGGTATCGGAGCTCGTGTCGGTGGTCTTGGCCAA
ATGCCAGGCTGGTGGTACAATGTGGAATCAATCTCAACGTCACATCTTCTTATGCAATTCAAGCTTGCAATTGAG
GCTGCCCTCAATTCCAAGACATCCGTCCGTGCAATGATGCGTGCGAGATCTGCAAAACAGCGTTTCCCTGTTGCT
CAATGGGTTGAAGATCTTGAGATCCTGCAATCTACTGCTATCGCGGTCCACAACAAAGTGGCGAAGGGTAATAAC
AACAACAATCGACCTGGCACTTCTTCTGGAGTCAGCACTTTCAGTGGAGCCCTGTCACCTTCACCTTCTATGACT
CAACTCGGAAGCCCACTTGCTTCACCCGGCCTGAACTCTCCATACACGCATTCTAGGGACAGCAGCTATTCCTTC
AACCAAATGAACAACCTTGCCCCTCAAAAGAAGGTCAGCTACAGCGCAGATACAAACCTGGACGACATGGAGAAA
CCAAAGTCGGGACTGAGCCGTTCTCTTTCCCTGGGTGTTCACTCAGGTCCTGGTCATGCTGGACGTCGCAGAGCA
GCAAAAGAGGCTGGTATCTCAGAAAGCGATGAAAACGGAGCCACTGATGCCGAAGGCGAGGATAGCAGCGACGAA
GACACTGCCCGCACCGTGTTTGGCGATGACGAATACACTCTCACTCCGGCTCAAGTCGAGGCAGGGCGACGAGCC
CAGGCTGCTCAAAGAGACCGTCCTCAAAACCTGCCTTCTCCAAGCCAGGAGTCTTTACATCCCAGGTTCATGCTT
CCTTTGGAAAGCCCGGGATCTCCGGGCACACCACCGAGCGCGGACAGCCTCCTTCTTCCTCCCCAGCCATTTGGC
CAGTCCAATCGTTTCAGCAGCGCATCCGTTCTCTCTCTGGACTCTGTTGTCGGCAACAAGACAGACTTCAAGCTA
CAGAAGGTTGATCCTTTCTTCACAGATAGCACTGGCGAGTACTACAGGACGTTTGATAAAAAGTTGGATGCCCTG
AACGGATCTAACTCCGAGTCGCAACTTTGTATCGAAGAGTTCTTGGTCAAGAGCGAGCAACAGTGGTTCGACAGG
TTCCGCAATGCCAGACTGGGTCGTACCAAATCTCCCACACCATCGATTCGACACTCATCAAGGAACACTGATACC
CCAGACAATATGTTCTACAGTGACGATCTCGTCTCCAACATTAATAGCAACGAAGAAAATCATCTCCAGGATGAT
GAGTTCCTTCTCGGAAAGGACTATGTCCCTCCCAGTGGACTTAAGAAATGGATGCAGATCAAAATTGGAGACTGG
CCGGTCTACTCCATTTTCCTCGCTCTAGGCCAGATCATCGCCGCAAACTCATACCAAATCACTCTACTCACCGGT
GAAGTTGGCCAGACCGCGGATAAGTTGTATGGAATTGCAACGACATATGCCATTGCATCCATGTGCTGGTGGCTC
GTGTACCGCTACTTCAAGTCTGTCGTTTGTCTTTCTACTCCGTGGTTCCTATATGCTTTTGCATTCCTCCTGATT
GGATCTGCTCACTGGCAAGATGATTCCTTCAGTCGGGGATGGATCCAGAATGTCGGTACCGGTTTCTACGCCGCG
GCCTCCGCTAGTGGATCTATCTTCTTCGCTTCAAACTTTGGTGATGAGGGAGGTGCTCCAGTTGAAACCTGGATT
TTCCGCGCCTGTGTCATTCAAGGTATTCAGCAGGCATACGTTATTGCCCTCTGGTACTGGGGTTCGACAATGACC
AAGGCTTCTTCAGAGGGTCTCTTGAGCGCTGAGTCAGGCATTGCCAATAGCTGGAAAATGAGTGCGATTTGTTAT
CCTATCACTGTCTTCCTGTGTTTCGTAGGCATTCTGTTGGCTTTGGGACTTCCCAACTACTACCGACAGAAGCCT
GGCAAGGTGCCGTCCTTCTACAAGTCCCTTTTCCGGAGAAAGATCGTCGCTTGGAACTTCGTCGCGGTCATCCTG
CAGAACTTCTTCCTGAGCGCACCATACGGTCGAAACTGGAGTTTCCTATGGGGTTCCTCGCACGCCCACGCATGG
CAGATCGTCATCCTCTGCATCGTCTTCTTCGGCGTTATCTGGTGTATATTCCTCTTCGTCGTTAGCAAATTCTCC
AAACGACACAGTTGGTTCCTTCCCGTTTTCGCCTGCGGCCTGGGCGCACCCCGCTTCATCCAAATCTGGTGGGCC
ATCTCGGGCATCGGGTACTATCTCCCCTGGGCTGGGAGTTATACTTCCGGCGCGCTGGTCTCTCGCAGTCTCTGG
CTATGGCTCGGCGTGTTGGATTCTATCCAAGGTCTTGGATTCGGTATCATCCTCCTACAGACTCTCACTCGAGTC
CACATGTGTTTCGCTCTCATTGCATCTCAGGTGCTGGGTTCCATTGCGACTATCTGCGCCCGAGCTTTCGGACCG
AACAGCGTAGGCCCCGGTCCAATTTCTCCTGACATGACTAAGGGCGCCCATTCCTTGGCTAATGGCTGGTTTTGG
GTTGCTTTGTTCTGTCAGTTGTTGATCTGTGCTGGGTTCTTGCTGTTCTTCCGCAAGGAACAACTCGCCAAACCA
TAA
Transcript >Pro_DTO377G3_2|g4806.t1
ATGAAGTGGCTACTCACCAGCGGATTGGTCTCGCTTCTTGCGAAAACCGTCACAGCTTGGCCATACGACGAGGCC
TACCTAGATTATAACCTCAATGAGAATAAGACGGCCACCAACCCAGCAGATTACTGGGGAACATGGCCTGGCCAT
GAGGGGAAATATCACCCCTCTCCAACAAATTGGCGCTTCCCGTTCTACTCTCTCTTCTTGGATCGCTTCGTGAAT
GGTGATCCTACCAATGACAACGCAAACGGTACCACGTTTGAGCATGATATTGAACAACGCATCCGCCATGGTGGC
GATGTGGCTGGCCTCGTCGAAACATTGGATTATCTCCAAGGAATGGGGATCAAGGGTCTCTATATTGCCGGAACC
TCCTTGCTGAATCAGCCGTGGACTTCAGACGGATATGGAGTTTTGGATACAACGATTCTCGACGCGCATTATGGA
ACTATCCAGACTTGGAGAGACGCCATCACCGAAATACACAAGCGCGGGATGTATGTCTTGTTCGACAATACTATT
GCGACAATGGGTGACTTGATTGGATTTGAAGGCCATCTAAACACATCTACTCCATTCTCGGAGAAGGAATATAGA
ACACAATGGAAGACTGAACGCCAATACAGAGACTTCACCATTGGAGCTGGCGACTACAATCAGACCTGTGACTAC
CCTCGATTCTGGTTCGAAGATGGATACCCCGTGAACGAATCAGAGACCTCAGGCTTGGTTGGATGTTACAACAGC
GACTTCGATCAGTACGGCGATATTGAGGCTTTCGGTGTGTGGCCTGATTGGAAGCGACAACTGGCCAAGTTCGCC
TCCGTCCAGGATCGTCTCCGCGAGTGGAACCCGACTGTGCGCGAAAGGTTGATCCGGCACTCCTGCATGATCATT
CAATCTTTAGATATTGATGGTTTCCGTTATGACAAGGGCACACAAGCTACCGTGGATGCTCTTGGAGACATGTCC
GCTGCCTACCGAGAATGTGCGCGCGCAGTTGGAAAAGAGAACTTCTTTATCACTGGCGAAATCACAGGTGGAAAC
GACTTTGGTGCCATTTACCTCGGAAGGGGTAGGCAGCGTAACCAGTGGCCTGAGAGCTCTGCCGAAACAATAAAG
TTGACAAATGAGTCCTCTGCCCAGTGGTTCTTACGCGAAGCGGGACATGAAGCCATCGATAGTGCAGCCTTCCAC
TATACGACATATCGTGCCCTGACTCGATTCCTTGGCATGGATGGGCAGCTTTCAGCCGGTTATGATGCGCCCGAT
GACTGGGTTTTGGGCTGGGACTGGATGGTGCAATCAAATGATTTGGTCAATGCTAACACCGGCAAGTTCGACCCT
CGACACATGTTTGGTGTGACGAATCAAGACGTCTTCCGTTGGCCATCGATTGCCAATGGTACACATCGGCAGTTG
CTCGGTTCTTTCGTGACTACATTGATGCTCCCCGGAATCCCACTTCTTCTTTGGGGCGAAGAGCAGAACTTCTAT
ATCTTAGATGCCACTGCGGAGAATTACATCTATGGGCGACAGGCAATGTCGCCTGCAACCGCGTGGAGAACTCAT
GGCTGCTTTAACCTGCAGTCCTCGCAGTACTACAAGTGGCCTGTTCTGGCAGCTAAAAAGGGCTGTGAGGATGTG
ACAGTTGCCTACGACCACCGCGACCCTTCCCACCCTCTTCGAAATATCATGAAGCAGATGTATCACTTGCGTGAA
CAGTACCCAATTCTCAATGACGGGTTTTACATTGGGAATTTGTCAAAGAAAACCGACTACGTTTACTACCCTGGT
TCCAATGGAACGGCCACGGAGACCGGAATGTGGTCCATTTACCGGGATATCAATACCAATGCGCAAAAATACGAA
TCCAAATATCAACCGGTCTGGCTTGTTTACCAAAACCTCAATGACACAAGGACATACACATTCGACTGCAACTCC
GACAATGTGACTAAGACACTGACTGCTCCATTCGATTCTGGTACCACTGTCAAGAACCTTTTCTACCCGTACGAC
GAGATCAAACTGGTGGATGGAGTGCGCAAACTCGGCTTGAATGGGTCCACGGAGTTGAATGGCTGTGCGGAAAGC
TTGAAAATGAAGGCATACGAGTTCCGTGCATACGTTCCTATCGCTAAACATCAATACCCTCGGCCCATGATCACC
AAATTCACCCCCGGCCATGATTTCCCACTGCGTTCTACTGTGGCGCCCAACCTTCCAGAGAATGTGACGGTTGAG
CTTTACTTCTCGGAAGAAATGGACTGTACCTCGGTGACCGGGGCAATTACCATCGATTCATCTACAGAGACTGGG
AAGGTTCCAACCCTAGATTCCGATACTGTGAAGTGCACAACTATCTCTCCCTTGCTCCAAACAAATTGGACTGCT
GAGATCCCAAGCGTTTGGAAGTGGACAGCAAACCTCACTGGAGTGTACAACGGAATCCATAAATTGACTGTCACC
AATGTTACCAACAAAGACACAAGCTCTTATACCTACGCTGTTGATCACTTCCTCTTCCGTGTCGGCCAGTTCGAT
AACCCTATGGTGTTCACTTCCGCCAACTACTCGAGCAGTCTACTCCACAAGAAGGACAACGGCGACCTCTTTATC
CAGCATCATGCTGCTGGTGCAGACAAATACCGTTATTCAACTAATTGGGCATCGTCATTCTCCAACTGGAAAGAA
TATAAAGGCGGAAATGATACCATCGAGAGGCTCCCATGGTCAGGAACCAAGAAACAAGAATGGGACGGTGAGCAT
GTGCGTGTTGAGTACTGGAGTCGTTTGACTGGAAGTAGCGACTACGTGCAGCAAGGTGACGCTGACTGGGACCAC
CCAGTCACACGACGTTTCCCCCATGCCTTCTTCAATGGACCCTACAACCAGTATGGATTCGACGGGGGCCTTGAC
AACAGAATCACACTCGACACCAAAACCGGAGTCTGGTCCTACCATTTCACGTCCGAATGGCCTGCAGTCGGTCAG
CTAAATATCTGGGGAATTAACCCAGACGGAAAGCCCGATCAAACCTGGGTTTTGGGTGATATCGACAATGACACA
GTCCTAGACCGAAGCCCACCGTCTGCTCTGAGCGCGACTTTGATCAATATCACCGCCGCGCCAGCGAAAGGCTAC
CTCTCTCACAAAATCTACTTCGACGATGGAACTCTCCATTTCTGGCTCGATCCGGTTGGACCTCAGTCCACACAG
ATTGCCATGTTCGTGTTATTCTGGATCATACCATTCCTCACTGCCGTGGGATGTGTGTACATCTTCATGAAGTCT
TTCTATAAGGTCAAATTCAACCAGGTCGGTGTGAGTGAGAAGCAAAACATTCCGCTCGCAATTTGGAACAAGATC
AAGACGTCCAGTGGTCACAGGGATCAATCCTCAAACCCACTAATGCGCTTAGCCAACAAATCCGGCTTCATGCAA
AGCACCACCGCTCTGGGCGGAGCTCTTGCTTCTGGCAAGCGACGCATGGTTCTAATCGCCACCATGGAGTACGAC
ATTGAGGATTGGGCCATCAAAATCAAAATCGGTGGTCTTGGTGTTATGGCTCAACTAATGGGTAAGACCCTAGGT
CACCAAGATCTCATCTGGGTCGTTCCTTGCGTTGGAGGTGTCGACTACCCTGTGGACCAAGAGGCAGAGCCTATG
GAAGTTACCATTCTCGGCAGCCCCTACCAGGTCCAAGTCCAATACCACGTCTTGAATAACATCACCTACGTCCTG
CTTGATGCTCCAGTGTTCCGTCAACAGTCAAAGTCCGAACCCTACCCTGCTCGTATGGATGATCTTGACAGTGCA
GTGTACTATTCAGCATGGAACCAGTGTATCGCGGAAGCCATCAAGCGATTCCCGATTGATACCTACCATATTAAC
GACTACCACGGTTCTCTCGCACCTCTTTACTTGCTCCCAAGAACTATCCCTGTTTGTCTCTCCTTGCACAATGCT
GAGTTCCAGGGTCTCTGGCCTATGCGAACTCTCAAGGAAAGAGAGGAGGTTTGCTCGGTCTTTAACCTTAACGAA
GAGGTCGCTCGTCGTTACGTGCAATTTGGTGAAGTGTTCAACTTACTCCACGCTGGCGCAAGCTATCTTCGTGTT
CACCAGTCAGGATTTGGTGCCGTCGGTGTTTCTAAGAAGTATGGTAAACGGTCCTATGCTCGCTATCCTATCTTC
TGGGGGTTGCATAAGATCGGCAATCTGCCTAACCCTGATCCATCTGACGTCGGTGAGTGGACAAAAGAGCCAACC
AAAGAGCAAGATATCACCGTTGATGCAACATACGAGGCTGGCCGTGGTGAGCTCAAGAGGCAGGCCCAGGAATGG
GCAGGACTCGATCAGAATCCTGATGCCGATCTACTTGTCTTTGTTGGTCGCTGGTCTATGCAAAAAGGTGTTGAT
CTCATTGCGGACGCAATGCCCGCTGTTATCGAAGCCCGGCCTAACGTGCAGCTGATCTGTATTGGCCCCGTTATC
GATCTCTACGGTAAATTCGCTGCTCTTAAGCTTGACCACATGATGAAAGTCTATCCCGGACGAGTCTTCTCAAAG
CCTGAATTCACTGCACTTCCGCCATTCATCTTCTCTGGGGCTGAGTTCGCCTTGATCCCATCTCGTGACGAGCCC
TTCGGTCTGGTTGCCGTCGAGTTTGGCCGAAAAGGTGCATTGGGTATCGGAGCTCGTGTCGGTGGTCTTGGCCAA
ATGCCAGGCTGGTGGTACAATGTGGAATCAATCTCAACGTCACATCTTCTTATGCAATTCAAGCTTGCAATTGAG
GCTGCCCTCAATTCCAAGACATCCGTCCGTGCAATGATGCGTGCGAGATCTGCAAAACAGCGTTTCCCTGTTGCT
CAATGGGTTGAAGATCTTGAGATCCTGCAATCTACTGCTATCGCGGTCCACAACAAAGTGGCGAAGGGTAATAAC
AACAACAATCGACCTGGCACTTCTTCTGGAGTCAGCACTTTCAGTGGAGCCCTGTCACCTTCACCTTCTATGACT
CAACTCGGAAGCCCACTTGCTTCACCCGGCCTGAACTCTCCATACACGCATTCTAGGGACAGCAGCTATTCCTTC
AACCAAATGAACAACCTTGCCCCTCAAAAGAAGGTCAGCTACAGCGCAGATACAAACCTGGACGACATGGAGAAA
CCAAAGTCGGGACTGAGCCGTTCTCTTTCCCTGGGTGTTCACTCAGGTCCTGGTCATGCTGGACGTCGCAGAGCA
GCAAAAGAGGCTGGTATCTCAGAAAGCGATGAAAACGGAGCCACTGATGCCGAAGGCGAGGATAGCAGCGACGAA
GACACTGCCCGCACCGTGTTTGGCGATGACGAATACACTCTCACTCCGGCTCAAGTCGAGGCAGGGCGACGAGCC
CAGGCTGCTCAAAGAGACCGTCCTCAAAACCTGCCTTCTCCAAGCCAGGAGTCTTTACATCCCAGGTTCATGCTT
CCTTTGGAAAGCCCGGGATCTCCGGGCACACCACCGAGCGCGGACAGCCTCCTTCTTCCTCCCCAGCCATTTGGC
CAGTCCAATCGTTTCAGCAGCGCATCCGTTCTCTCTCTGGACTCTGTTGTCGGCAACAAGACAGACTTCAAGCTA
CAGAAGGTTGATCCTTTCTTCACAGATAGCACTGGCGAGTACTACAGGACGTTTGATAAAAAGTTGGATGCCCTG
AACGGATCTAACTCCGAGTCGCAACTTTGTATCGAAGAGTTCTTGGTCAAGAGCGAGCAACAGTGGTTCGACAGG
TTCCGCAATGCCAGACTGGGTCGTACCAAATCTCCCACACCATCGATTCGACACTCATCAAGGAACACTGATACC
CCAGACAATATGTTCTACAGTGACGATCTCGTCTCCAACATTAATAGCAACGAAGAAAATCATCTCCAGGATGAT
GAGTTCCTTCTCGGAAAGGACTATGTCCCTCCCAGTGGACTTAAGAAATGGATGCAGATCAAAATTGGAGACTGG
CCGGTCTACTCCATTTTCCTCGCTCTAGGCCAGATCATCGCCGCAAACTCATACCAAATCACTCTACTCACCGGT
GAAGTTGGCCAGACCGCGGATAAGTTGTATGGAATTGCAACGACATATGCCATTGCATCCATGTGCTGGTGGCTC
GTGTACCGCTACTTCAAGTCTGTCGTTTGTCTTTCTACTCCGTGGTTCCTATATGCTTTTGCATTCCTCCTGATT
GGATCTGCTCACTGGCAAGATGATTCCTTCAGTCGGGGATGGATCCAGAATGTCGGTACCGGTTTCTACGCCGCG
GCCTCCGCTAGTGGATCTATCTTCTTCGCTTCAAACTTTGGTGATGAGGGAGGTGCTCCAGTTGAAACCTGGATT
TTCCGCGCCTGTGTCATTCAAGGTATTCAGCAGGCATACGTTATTGCCCTCTGGTACTGGGGTTCGACAATGACC
AAGGCTTCTTCAGAGGGTCTCTTGAGCGCTGAGTCAGGCATTGCCAATAGCTGGAAAATGAGTGCGATTTGTTAT
CCTATCACTGTCTTCCTGTGTTTCGTAGGCATTCTGTTGGCTTTGGGACTTCCCAACTACTACCGACAGAAGCCT
GGCAAGGTGCCGTCCTTCTACAAGTCCCTTTTCCGGAGAAAGATCGTCGCTTGGAACTTCGTCGCGGTCATCCTG
CAGAACTTCTTCCTGAGCGCACCATACGGTCGAAACTGGAGTTTCCTATGGGGTTCCTCGCACGCCCACGCATGG
CAGATCGTCATCCTCTGCATCGTCTTCTTCGGCGTTATCTGGTGTATATTCCTCTTCGTCGTTAGCAAATTCTCC
AAACGACACAGTTGGTTCCTTCCCGTTTTCGCCTGCGGCCTGGGCGCACCCCGCTTCATCCAAATCTGGTGGGCC
ATCTCGGGCATCGGGTACTATCTCCCCTGGGCTGGGAGTTATACTTCCGGCGCGCTGGTCTCTCGCAGTCTCTGG
CTATGGCTCGGCGTGTTGGATTCTATCCAAGGTCTTGGATTCGGTATCATCCTCCTACAGACTCTCACTCGAGTC
CACATGTGTTTCGCTCTCATTGCATCTCAGGTGCTGGGTTCCATTGCGACTATCTGCGCCCGAGCTTTCGGACCG
AACAGCGTAGGCCCCGGTCCAATTTCTCCTGACATGACTAAGGGCGCCCATTCCTTGGCTAATGGCTGGTTTTGG
GTTGCTTTGTTCTGTCAGTTGTTGATCTGTGCTGGGTTCTTGCTGTTCTTCCGCAAGGAACAACTCGCCAAACCA
TAA
Gene >Pro_DTO377G3_2|g4806.t1
ATGAAGTGGCTACTCACCAGCGGATTGGTCTCGCTTCTTGCGAAAACCGTCACAGCTTGGCCATACGACGAGGCC
TACCTAGATTATAACCTCAATGAGAATAAGACGGCCACCAACCCAGCAGATTACTGGGGAACATGGCCTGGCCAT
GAGGGGAAATATCACCCCTCTCCAACAAATTGGCGCTTCCCGTTCTACTCTCTCTTCTTGGATCGCTTCGTGAAT
GGTGATCCTACCAATGACAACGCAAACGGTACCACGTTTGAGCATGATATTGAACAACGCATCCGCCATGGTGGC
GATGTGGCTGGCCTCGTCGAAACATTGGATTATCTCCAAGGAATGGGGATCAAGGTTTGTCTCATCTGTGATCTT
CTAGTGGCAAGAAAATATATGCTCACAATGTTCAGGGTCTCTATATTGCCGGAACCTCCTTGCTGAATCAGCCGT
GGACTTCAGACGGATATGGAGTTTTGGATACAACGATTCTCGACGCGCATTATGGAACTATCCAGACTTGGAGAG
ACGCCATCACCGAAATACACAAGCGCGGGATGTATGTCTTGTTCGACAATACTATTGCGACGTAAGTTGTCCCCG
TGTGCATAAACAAGAGACCAGTGCTAACTGAATATATCCAGAATGGGTGACTTGATTGGATTTGAAGGCCATCTA
AACACATCTACTCCATTCTCGGAGAAGGAATATAGAACACAATGGAAGACTGAACGCCAATACAGAGACTTCACC
ATTGGAGCTGGCGACTACAATCAGACCTGTGACTACCCTCGATTCTGGTTCGAAGATGGATACCCCGTGAACGAA
TCAGAGACCTCAGGCTTGGTTGGATGTTACAACAGCGACTTCGATCAGTACGGCGATATTGAGGCTTTCGGTGTG
TGGCCTGATTGGAAGCGACAACTGGCCAAGTTCGCCTCCGTCCAGGATCGTCTCCGCGAGTGGAACCCGACTGTG
CGCGAAAGGTTGATCCGGCACTCCTGCATGATCATTCAATCTTTAGATATTGATGGTTTCCGTTATGACAAGGGC
ACACAAGCTACCGTGGATGCTCTTGGAGACATGTCCGCTGCCTACCGAGAATGTGCGCGCGCAGTTGGAAAAGAG
AACTTCTTTATCACTGGCGAAATCACAGGTGGAAACGACTTTGGTGCCATTTACCTCGGAAGGGGTAGGCAGCGT
AACCAGTGGCCTGAGAGCTCTGCCGAAACAATAAAGTTGACAAATGAGTCCTCTGCCCAGTGGTTCTTACGCGAA
GCGGGACATGAAGCCATCGATAGTGCAGCCTTCCACTATACGACATATCGTGCCCTGACTCGATTCCTTGGCATG
GATGGGCAGCTTTCAGCCGGTTATGATGCGCCCGATGACTGGGTTTTGGGCTGGGACTGGATGGTGCAATCAAAT
GATTTGGTCAATGCTAACACCGGCAAGTTCGACCCTCGACACATGTTTGGTGTGACGAATCAAGACGTCTTCCGT
TGGCCATCGATTGCCAATGGTACACATCGGCAGTTGCTCGGTTCTTTCGTGACTACATTGATGCTCCCCGGAATC
CCACTTCTTCTTTGGGGCGAAGAGCAGAACTTCTATATCTTAGATGCCACTGCGGAGAATTACATCTATGGGCGA
CAGGCAATGTCGCCTGCAACCGCGTGGAGAACTCATGGCTGCTTTAACCTGCAGTCCTCGCAGTACTACAAGTGG
CCTGTTCTGGCAGCTAAAAAGGGCTGTGAGGATGTGACAGTTGCCTACGACCACCGCGACCCTTCCCACCCTCTT
CGAAATATCATGAAGCAGATGTATCACTTGCGTGAACAGTACCCAATTCTCAATGACGGGTTTTACATTGGGAAT
TTGTCAAAGAAAACCGACTACGTTTACTACCCTGGTTCCAATGGAACGGCCACGGAGACCGGAATGTGGTCCATT
TACCGGGATATCAATACCAATGCGCAAAAATACGAATCCAAATATCAACCGGTCTGGCTTGTTTACCAAAACCTC
AATGACACAAGGACATACACATTCGACTGCAACTCCGACAATGTGACTAAGACACTGACTGCTCCATTCGATTCT
GGTACCACTGTCAAGAACCTTTTCTACCCGTACGACGAGATCAAACTGGTGGATGGAGTGCGCAAACTCGGCTTG
AATGGGTCCACGGAGTTGAATGGCTGTGCGGAAAGCTTGAAAATGAAGGCATACGAGTTCCGTGCATACGTTCCT
ATCGCTAAACATCAATACCCTCGGCCCATGATCACCAAATTCACCCCCGGCCATGATTTCCCACTGCGTTCTACT
GTGGCGCCCAACCTTCCAGAGAATGTGACGGTTGAGCTTTACTTCTCGGAAGAAATGGACTGTACCTCGGTGACC
GGGGCAATTACCATCGATTCATCTACAGAGACTGGGAAGGTTCCAACCCTAGATTCCGATACTGTGAAGTGCACA
ACTATCTCTCCCTTGCTCCAAACAAATTGGACTGCTGAGATCCCAAGCGTTTGGAAGTGGACAGCAAACCTCACT
GGAGTGTACAACGGAATCCATAAATTGACTGTCACCAATGTTACCAACAAAGACACAAGCTCTTATACCTACGCT
GTTGATCACTTCCTCTTCCGTGTCGGCCAGTTCGATAACCCTATGGTGTTCACTTCCGCCAACTACTCGAGCAGT
CTACTCCACAAGAAGGACAACGGCGACCTCTTTATCCAGCATCATGCTGCTGGTGCAGACAAATACCGTTATTCA
ACTAATTGGGCATCGTCATTCTCCAACTGGAAAGAATATAAAGGCGGAAATGATACCATCGAGAGGCTCCCATGG
TCAGGAACCAAGAAACAAGAATGGGACGGTGAGCATGTGCGTGTTGAGTACTGGAGTCGTTTGACTGGAAGTAGC
GACTACGTGCAGCAAGGTGACGCTGACTGGGACCACCCAGTCACACGACGTTTCCCCCATGCCTTCTTCAATGGA
CCCTACAACCAGTATGGATTCGACGGGGGCCTTGACAACAGAATCACACTCGACACCAAAACCGGAGTCTGGTCC
TACCATTTCACGTCCGAATGGCCTGCAGTCGGTCAGCTAAATATCTGGGGAATTAACCCAGACGGAAAGCCCGAT
CAAACCTGGGTTTTGGGTGATATCGACAATGACACAGTCCTAGACCGAAGCCCACCGTCTGCTCTGAGCGCGACT
TTGATCAATATCACCGCCGCGCCAGCGAAAGGCTACCTCTCTCACAAAATCTACTTCGACGATGGAACTCTCCAT
TTCTGGCTCGATCCGGTTGGACCTCAGTCCACACAGATTGCCATGTTCGTGTTATTCTGGATCATACCATTCCTC
ACTGCCGTGGGATGTGTGTACATCTTCATGAAGTCTTTCTATAAGGTCAAATTCAACCAGGTCGGTGTGAGTGAG
AAGCAAAACATTCCGCTCGCAATTTGGAACAAGATCAAGACGTCCAGTGGTCACAGGGATCAATCCTCAAACCCA
CTAATGCGCTTAGCCAACAAATCCGGCTTCATGCAAAGCACCACCGCTCTGGGCGGAGCTCTTGCTTCTGGCAAG
CGACGCATGGTTCTAATCGCCACCATGGAGTACGACATTGAGGATTGGGCCATCAAAATCAAAATCGGTGGTCTT
GGTGTTATGGCTCAACTAATGGGTAAGACCCTAGGTCACCAAGATCTCATCTGGGTCGTTCCTTGCGTTGGAGGT
GTCGACTACCCTGTGGACCAAGAGGCAGAGCCTATGGAAGTTACCATTCTCGGCAGCCCCTACCAGGTCCAAGTC
CAATACCACGTCTTGAATAACATCACCTACGTCCTGCTTGATGCTCCAGTGTTCCGTCAACAGTCAAAGTCCGAA
CCCTACCCTGCTCGTATGGATGATCTTGACAGTGCAGTGTACTATTCAGCATGGAACCAGTGTATCGCGGAAGCC
ATCAAGCGATTCCCGATTGATACCTACCATATTAACGACTACCACGGTTCTCTCGCACCTCTTTACTTGCTCCCA
AGAACTATCCCTGTTTGTCTCTCCTTGCACAATGCTGAGTTCCAGGGTCTCTGGCCTATGCGAACTCTCAAGGAA
AGAGAGGAGGTTTGCTCGGTCTTTAACCTTAACGAAGAGGTCGCTCGTCGTTACGTGCAATTTGGTGAAGTGTTC
AACTTACTCCACGCTGGCGCAAGCTATCTTCGTGTTCACCAGTCAGGATTTGGTGCCGTCGGTGTTTCTAAGAAG
TATGGTAAACGGTCCTATGCTCGCTATCCTATCTTCTGGGGGTTGCATAAGATCGGCAATCTGCCTAACCCTGAT
CCATCTGACGTCGGTGAGTGGACAAAAGAGCCAACCAAAGAGCAAGATATCACCGTTGATGCAACATACGAGGCT
GGCCGTGGTGAGCTCAAGAGGCAGGCCCAGGAATGGGCAGGACTCGATCAGAATCCTGATGCCGATCTACTTGTC
TTTGTTGGTCGCTGGTCTATGCAAAAAGGTGTTGATCTCATTGCGGACGCAATGCCCGCTGTTATCGAAGCCCGG
CCTAACGTGCAGCTGATCTGTATTGGCCCCGTTATCGATCTCTACGGTAAATTCGCTGCTCTTAAGCTTGACCAC
ATGATGAAAGTCTATCCCGGACGAGTCTTCTCAAAGCCTGAATTCACTGCACTTCCGCCATTCATCTTCTCTGGG
GCTGAGTTCGCCTTGATCCCATCTCGTGACGAGCCCTTCGGTCTGGTTGCCGTCGAGTTTGGCCGAAAAGGTGCA
TTGGGTATCGGAGCTCGTGTCGGTGGTCTTGGCCAAATGCCAGGCTGGTGGTACAATGTGGAATCAATCTCAACG
TCACATCTTCTTATGCAATTCAAGCTTGCAATTGAGGCTGCCCTCAATTCCAAGACATCCGTCCGTGCAATGATG
CGTGCGAGATCTGCAAAACAGCGTTTCCCTGTTGCTCAATGGGTTGAAGATCTTGAGATCCTGCAATCTACTGCT
ATCGCGGTCCACAACAAAGTGGCGAAGGGTAATAACAACAACAATCGACCTGGCACTTCTTCTGGAGTCAGCACT
TTCAGTGGAGCCCTGTCACCTTCACCTTCTATGACTCAACTCGGAAGCCCACTTGCTTCACCCGGCCTGAACTCT
CCATACACGCATTCTAGGGACAGCAGCTATTCCTTCAACCAAATGAACAACCTTGCCCCTCAAAAGAAGGTCAGC
TACAGCGCAGATACAAACCTGGACGACATGGAGAAACCAAAGTCGGGACTGAGCCGTTCTCTTTCCCTGGGTGTT
CACTCAGGTCCTGGTCATGCTGGACGTCGCAGAGCAGCAAAAGAGGCTGGTATCTCAGAAAGCGATGAAAACGGA
GCCACTGATGCCGAAGGCGAGGATAGCAGCGACGAAGACACTGCCCGCACCGTGTTTGGCGATGACGAATACACT
CTCACTCCGGCTCAAGTCGAGGCAGGGCGACGAGCCCAGGCTGCTCAAAGAGACCGTCCTCAAAACCTGCCTTCT
CCAAGCCAGGAGTCTTTACATCCCAGGTTCATGCTTCCTTTGGAAAGCCCGGGATCTCCGGGCACACCACCGAGC
GCGGACAGCCTCCTTCTTCCTCCCCAGCCATTTGGCCAGTCCAATCGTTTCAGCAGCGCATCCGTTCTCTCTCTG
GACTCTGTTGTCGGCAACAAGACAGACTTCAAGCTACAGAAGGTTGATCCTTTCTTCACAGATAGCACTGGCGAG
TACTACAGGACGTTTGATAAAAAGTTGGATGCCCTGAACGGATCTAACTCCGAGTCGCAACTTTGTATCGAAGAG
TTCTTGGTCAAGAGCGAGCAACAGTGGTTCGACAGGTTCCGCAATGCCAGACTGGGTCGTACCAAATCTCCCACA
CCATCGATTCGACACTCATCAAGGAACACTGATACCCCAGACAATATGTTCTACAGTGACGATCTCGTCTCCAAC
ATTAATAGCAACGAAGAAAATCATCTCCAGGATGATGAGTTCCTTCTCGGAAAGGACTATGTCCCTCCCAGTGGA
CTTAAGAAATGGATGCAGATCAAAATTGGAGACTGGCCGGTCTACTCCATTTTCCTCGCTCTAGGCCAGATCATC
GCCGCAAACTCATACCAAATCACTCTACTCACCGGTGAAGTTGGCCAGACCGCGGATAAGTTGTATGGAATTGCA
ACGACATATGCCATTGCATCCATGTGCTGGTGGCTCGTGTACCGCTACTTCAAGTCTGTCGTTTGTCTTTCTACT
CCGTGGTTCCTATATGCTTTTGCATTCCTCCTGATTGGATCTGCTCACTGGCAAGATGATTCCTTCAGTCGGGGA
TGGATCCAGAATGTCGGTACCGGTTTCTACGCCGCGGCCTCCGCTAGTGGATCTATCTTCTTCGCTTCAAACTTT
GGTGATGAGGGAGGTGCTCCAGTTGAAACCTGGATTTTCCGCGCCTGTGTCATTCAAGGTATTCAGCAGGCATAC
GTTATTGCCCTCTGGTACTGGGGTTCGACAATGACCAAGGCTTCTTCAGAGGGTCTCTTGAGCGCTGAGTCAGGC
ATTGCCAATAGCTGGAAAATGAGGTGAATAGCCCCGTACACTGATCTCCTTCCTTACTTTACTAACATTACTCCA
GTGCGATTTGTTATCCTATCACTGTCTTCCTGTGTTTCGTAGGCATTCTGTTGGCTTTGGGACTTCCCAACTACT
ACCGACAGAAGCCTGGCAAGGTGCCGTCCTTCTACAAGTCCCTTTTCCGGAGAAAGATCGTCGCTTGGAACTTCG
TCGCGGTCATCCTGCAGAACTTCTTCCTGAGCGCACCATACGGTCGAAACTGGAGTTGTAAGTTCAATCTTCCCA
ATCGAACTCTGGCATACCGATCAGTACTAACATTCCTCTCTCCCAGTCCTATGGGGTTCCTCGCACGCCCACGCA
TGGCAGATCGTCATCCTCTGCATCGTCTTCTTCGGCGTTATCTGGTGTATATTCCTCTTCGTCGTTAGCAAATTC
TCCAAACGACACAGTTGGTTCCTTCCCGTTTTCGCCTGCGGCCTGGGCGCACCCCGCTTCATCCAAATCTGGTGG
GCCATCTCGGGCATCGGGTACTATCTCCCCTGGGCTGGGAGTTATACTTCCGGCGCGCTGGTCTCTCGCAGTCTC
TGGCTATGGCTCGGCGTGTTGGATTCTATCCAAGGTCTTGGATTCGGTATCATCCTCCTACAGACTCTCACTCGA
GTCCACATGTGTTTCGCTCTCATTGCATCTCAGGTGCTGGGTTCCATTGCGACTATCTGCGCCCGAGCTTTCGGA
CCGAACAGCGTAGGCCCCGGTCCAATTTCTCCTGACATGACTAAGGGCGCCCATTCCTTGGCTAATGGCTGGTTT
TGGGTTGCTTTGTTCTGTCAGTTGTTGATCTGGTATGTTGCTCCTTGCTTGTCTCGTTCAGCGGAATTATTTCTA
ACATTTATCTGCAGTGCTGGGTTCTTGCTGTTCTTCCGCAAGGAACAACTCGCCAAACCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail