Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4778.t1
Gene name
Locationscaffold_10:374005..375080
Strand-
Gene length (bp)1075
Transcript length (bp)834
Coding sequence length (bp)834
Protein length (aa) 278

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01184 Gpr1_Fun34_YaaH GPR1/FUN34/yaaH family 5.1E-27 52 259

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 61 80 19
2 90 112 22
3 119 141 22
4 161 180 19
5 187 209 22
6 224 241 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4778.t1
MSDDTIGDKPETSTAEMLRRYQTTDSVMLPIPRDVFEKLYLSPKTPNAGKLRSTFGNPTPISLMGFLLSATPTAM
LTMGWRGAGGNGGAILPVYIFFGAMVQIFGAIGEWILGNTFSCALFFTYGTFWLVQGTSLMPFFAVGTMYSSDGN
TLKGMETAEYSATVGFYYVTLALITFVYTICALRTNVCLFLALFLLVITFGLFSGIYFQMALGNLVLAAKLQKAA
GAFTFALCLPIWHIFIAQILEAVDFPIALPVGDLSTVILGRSQKARKCEVEG*
Coding >Pro_DTO377G3_2|g4778.t1
ATGTCCGACGATACTATCGGCGACAAGCCAGAGACCTCTACGGCAGAAATGCTTCGTCGGTATCAGACCACCGAC
AGTGTTATGCTTCCTATACCACGGGATGTTTTTGAAAAGCTATACCTTAGCCCCAAGACGCCAAATGCAGGAAAG
CTGCGTTCCACATTTGGAAATCCCACGCCGATTTCATTGATGGGTTTCTTGCTGTCTGCGACGCCGACCGCAATG
CTTACCATGGGATGGAGAGGAGCAGGTGGAAACGGTGGTGCCATTTTACCAGTCTATATCTTCTTCGGTGCAATG
GTACAAATATTCGGAGCAATTGGCGAATGGATTCTAGGGAATACATTTTCTTGCGCATTATTCTTCACATATGGT
ACATTCTGGCTGGTTCAGGGAACATCGCTCATGCCATTCTTTGCCGTTGGCACAATGTACTCGTCTGATGGCAAC
ACACTGAAAGGCATGGAGACCGCTGAATACAGCGCAACTGTCGGTTTCTACTACGTCACTCTCGCACTCATCACC
TTCGTATACACAATTTGCGCCCTCCGCACGAACGTCTGCCTCTTCCTCGCGCTCTTTCTGCTTGTGATCACATTT
GGATTATTTTCAGGAATATATTTCCAGATGGCGCTGGGGAACCTAGTGCTGGCGGCCAAATTACAAAAGGCGGCT
GGTGCGTTCACCTTTGCCCTCTGTCTTCCGATTTGGCATATTTTCATTGCGCAGATCCTCGAAGCGGTCGATTTC
CCCATCGCACTGCCAGTGGGCGACCTAAGTACAGTCATCCTGGGGAGGAGTCAGAAAGCCCGGAAGTGTGAGGTT
GAGGGGTAG
Transcript >Pro_DTO377G3_2|g4778.t1
ATGTCCGACGATACTATCGGCGACAAGCCAGAGACCTCTACGGCAGAAATGCTTCGTCGGTATCAGACCACCGAC
AGTGTTATGCTTCCTATACCACGGGATGTTTTTGAAAAGCTATACCTTAGCCCCAAGACGCCAAATGCAGGAAAG
CTGCGTTCCACATTTGGAAATCCCACGCCGATTTCATTGATGGGTTTCTTGCTGTCTGCGACGCCGACCGCAATG
CTTACCATGGGATGGAGAGGAGCAGGTGGAAACGGTGGTGCCATTTTACCAGTCTATATCTTCTTCGGTGCAATG
GTACAAATATTCGGAGCAATTGGCGAATGGATTCTAGGGAATACATTTTCTTGCGCATTATTCTTCACATATGGT
ACATTCTGGCTGGTTCAGGGAACATCGCTCATGCCATTCTTTGCCGTTGGCACAATGTACTCGTCTGATGGCAAC
ACACTGAAAGGCATGGAGACCGCTGAATACAGCGCAACTGTCGGTTTCTACTACGTCACTCTCGCACTCATCACC
TTCGTATACACAATTTGCGCCCTCCGCACGAACGTCTGCCTCTTCCTCGCGCTCTTTCTGCTTGTGATCACATTT
GGATTATTTTCAGGAATATATTTCCAGATGGCGCTGGGGAACCTAGTGCTGGCGGCCAAATTACAAAAGGCGGCT
GGTGCGTTCACCTTTGCCCTCTGTCTTCCGATTTGGCATATTTTCATTGCGCAGATCCTCGAAGCGGTCGATTTC
CCCATCGCACTGCCAGTGGGCGACCTAAGTACAGTCATCCTGGGGAGGAGTCAGAAAGCCCGGAAGTGTGAGGTT
GAGGGGTAG
Gene >Pro_DTO377G3_2|g4778.t1
ATGTCCGACGATACTATCGGCGACAAGCCAGAGACCTCTACGGCAGAAATGCTTCGTCGGTATCAGACCACCGAC
AGTGTTATGCTTCCTATACCACGGGATGTTTTTGAAAAGCTATACCTTAGCCCCAAGACGCCAAATGCAGGAAAG
CTGCGTTCCACATTTGGAAATCCCACGCCGATTTCATTGATGGGTTTCTTGCTGTCTGCGACGCCGACCGCAATG
CTTACCATGGGATGGAGAGGAGCAGGTGGAAACGGTGGTGCCATTTTGTAAGAGAGGCCATACTGATGCTGCAAG
GAAAACAGTACTAACAACTCCCTCCCACAGACCAGTCTATATCTTCTTCGGTGCAATGGTACAAATATTCGGAGC
AATTGGCGAATGGATTCTAGGGAATACATTTTCTTGCGCATTATTCTTCACATATGGTATGTGTAGTTCGTCATG
GATTAGGGACGCATCCATGCATTTGCTAACTGGAGCTCATAGGTACATTCTGGCTGGTTCAGGGAACATCGCTCA
TGCCATTCTTTGCCGTTGGCACAATGTACTCGTCTGATGGCAACACACTGAAAGGCATGGAGACCGCTGAATACA
GCGCAACTGTCGGTGAGTCTTACCTTTCACACCCCATCATGTACATGTGCACGTCCTGACCGAATATATTACAGG
TTTCTACTACGTCACTCTCGCACTCATCACCTTCGTATACACAATTTGCGCCCTCCGCACGAACGTCTGCCTCTT
CCTCGCGCTCTTTCTGCTTGTGATCACATTTGGATTATTTTCAGGAATATATTTCCAGATGGCGCTGGGGAACCT
AGTGCTGGCGGCCAAATTACAAAAGGTATATTGCAAATATGGTATTGTTCTCTTCGATATTAAATGTGTACTGAT
TTATCAATAGGCGGCTGGTGCGTTCACCTTTGCCCTCTGTCTTCCGATTTGGCATATTTTCATTGCGCAGATCCT
CGAAGCGGTCGATTTCCCCATCGCACTGCCAGTGGGCGACCTAAGTACAGTCATCCTGGGGAGGAGTCAGAAAGC
CCGGAAGTGTGAGGTTGAGGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail