Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4756.t1
Gene name
Locationscaffold_10:317354..318955
Strand+
Gene length (bp)1601
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-29 38 428
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.7E-08 76 236

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 100 119 19
3 126 148 22
4 163 185 22
5 192 214 22
6 270 292 22
7 301 323 22
8 349 371 22
9 378 400 22
10 443 465 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.77 0.67 4.86
5d_25C Five days - 25 degrees Celsius 0.93 0.00 1.87
7d_25C Seven days - 25 degrees Celsius 1.14 0.05 2.22
10d_25C Ten days - 25 degrees Celsius 0.66 0.00 1.41
7d_15C Seven days - 15 degrees Celsius 33.09 18.18 48.00
7d_30C Seven days - 30 degrees Celsius 0.46 0.00 1.02

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.025858 yes
3d_25C 7d_25C 0.074116 no
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.004840 yes
3d_25C 10d_25C 0.011993 yes
5d_25C 7d_25C 0.795906 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.278993 no
5d_25C 10d_25C 0.641991 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.157617 no
7d_25C 10d_25C 0.418753 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4756.t1
MSDKDKDIKIHTWDGPDDPENPFNWSFRYKWVITITVCFISILTGIPAGSYGSGNDWLKQEFNVQNTPFPNLYWA
TTSWNMGAAFWPLIFVPLTESSGRMPGYFVAYILLVISLFPSAFAKNFATLIVTRFFGGGASSTAINIVGGSISD
VWFGNEARSLPMSIFGFTSVVGISLGPFIGSSIVQIHRSHPWRWIFYIQIIYNAALIPVFWLILKETRPEVILKK
RAKKIRKETNLPIYASSELDAPSKLNLLRLSFQRPTHMLIAEPVVTFFTLWISFAWGILFLFFSSVVQTYSTNYN
WGTMSTGLIQLAISVGAVIGTVINPLQDWIHLRSERHNKENPGKPIPEARLYTSIPGSLLFAAGLFWYGWASQPH
VHWIVPTIGVTATGIGIYSIYMAVVNYLTDAYERYAASALSAASLGRNTFGAFLPLASPQLFSNLGYGWAGTLLG
FIGIALSVVPVVLVWKGPEIRRRSKFMREAMWEPSQRPG*
Coding >Pro_DTO377G3_2|g4756.t1
ATGTCTGATAAGGATAAAGATATCAAAATCCACACATGGGATGGGCCCGATGACCCCGAGAATCCCTTCAATTGG
AGCTTCAGATACAAATGGGTGATAACGATTACCGTTTGCTTCATCTCCATCCTGACAGGAATCCCCGCAGGAAGC
TACGGCTCCGGCAACGACTGGTTGAAGCAAGAATTCAATGTCCAAAACACCCCCTTCCCAAACCTCTACTGGGCC
ACCACTTCCTGGAACATGGGCGCCGCCTTCTGGCCACTGATTTTCGTCCCTCTGACAGAGTCCTCCGGCCGCATG
CCAGGATACTTCGTGGCGTATATACTCCTCGTCATTTCGCTCTTCCCATCCGCGTTCGCAAAGAACTTCGCGACA
CTCATCGTGACTCGGTTCTTCGGTGGAGGTGCTTCTTCCACCGCGATTAATATTGTCGGGGGAAGTATCTCCGAT
GTGTGGTTCGGTAACGAGGCTCGCAGTCTGCCCATGTCTATATTCGGATTTACGAGTGTTGTCGGTATTTCACTT
GGTCCATTTATTGGATCTTCTATTGTGCAGATTCATAGATCACACCCATGGCGTTGGATCTTCTACATCCAAATT
ATCTACAACGCAGCCTTGATCCCGGTCTTTTGGCTAATACTCAAAGAAACCCGCCCAGAAGTGATCCTTAAGAAG
CGCGCAAAGAAGATCCGCAAAGAAACAAACCTCCCCATCTACGCCTCTTCCGAACTAGATGCCCCAAGCAAACTC
AATCTCTTGAGACTCTCCTTCCAACGCCCAACACACATGCTCATAGCCGAGCCGGTCGTGACCTTCTTCACTTTA
TGGATAAGTTTCGCCTGGGGGATCCTGTTCCTCTTCTTTTCCAGCGTCGTGCAAACCTACTCCACAAACTACAAC
TGGGGTACGATGTCAACAGGCCTGATACAGCTCGCCATCTCGGTGGGTGCGGTCATCGGGACAGTCATCAACCCG
CTGCAGGACTGGATTCATCTCCGCTCTGAGCGGCATAATAAAGAGAACCCGGGGAAACCTATCCCTGAGGCGAGA
CTGTACACATCTATCCCGGGTAGTCTGCTATTTGCGGCGGGTTTGTTCTGGTACGGCTGGGCTAGTCAGCCGCAT
GTTCATTGGATCGTGCCGACTATCGGTGTTACGGCGACAGGGATTGGGATCTATTCGATTTATATGGCTGTTGTT
AATTATTTGACTGATGCTTATGAGCGTTATGCGGCATCGGCTTTGTCGGCTGCTTCGCTTGGGAGGAATACTTTT
GGTGCGTTCTTGCCGCTTGCTTCGCCGCAGTTGTTCTCCAATCTCGGGTATGGATGGGCGGGGACTTTGCTTGGG
TTTATTGGGATTGCGTTGTCTGTCGTGCCTGTTGTTTTGGTTTGGAAAGGCCCGGAGATTCGGAGGAGGAGCAAG
TTTATGAGGGAGGCGATGTGGGAGCCTTCGCAGAGGCCGGGCTAG
Transcript >Pro_DTO377G3_2|g4756.t1
ATGTCTGATAAGGATAAAGATATCAAAATCCACACATGGGATGGGCCCGATGACCCCGAGAATCCCTTCAATTGG
AGCTTCAGATACAAATGGGTGATAACGATTACCGTTTGCTTCATCTCCATCCTGACAGGAATCCCCGCAGGAAGC
TACGGCTCCGGCAACGACTGGTTGAAGCAAGAATTCAATGTCCAAAACACCCCCTTCCCAAACCTCTACTGGGCC
ACCACTTCCTGGAACATGGGCGCCGCCTTCTGGCCACTGATTTTCGTCCCTCTGACAGAGTCCTCCGGCCGCATG
CCAGGATACTTCGTGGCGTATATACTCCTCGTCATTTCGCTCTTCCCATCCGCGTTCGCAAAGAACTTCGCGACA
CTCATCGTGACTCGGTTCTTCGGTGGAGGTGCTTCTTCCACCGCGATTAATATTGTCGGGGGAAGTATCTCCGAT
GTGTGGTTCGGTAACGAGGCTCGCAGTCTGCCCATGTCTATATTCGGATTTACGAGTGTTGTCGGTATTTCACTT
GGTCCATTTATTGGATCTTCTATTGTGCAGATTCATAGATCACACCCATGGCGTTGGATCTTCTACATCCAAATT
ATCTACAACGCAGCCTTGATCCCGGTCTTTTGGCTAATACTCAAAGAAACCCGCCCAGAAGTGATCCTTAAGAAG
CGCGCAAAGAAGATCCGCAAAGAAACAAACCTCCCCATCTACGCCTCTTCCGAACTAGATGCCCCAAGCAAACTC
AATCTCTTGAGACTCTCCTTCCAACGCCCAACACACATGCTCATAGCCGAGCCGGTCGTGACCTTCTTCACTTTA
TGGATAAGTTTCGCCTGGGGGATCCTGTTCCTCTTCTTTTCCAGCGTCGTGCAAACCTACTCCACAAACTACAAC
TGGGGTACGATGTCAACAGGCCTGATACAGCTCGCCATCTCGGTGGGTGCGGTCATCGGGACAGTCATCAACCCG
CTGCAGGACTGGATTCATCTCCGCTCTGAGCGGCATAATAAAGAGAACCCGGGGAAACCTATCCCTGAGGCGAGA
CTGTACACATCTATCCCGGGTAGTCTGCTATTTGCGGCGGGTTTGTTCTGGTACGGCTGGGCTAGTCAGCCGCAT
GTTCATTGGATCGTGCCGACTATCGGTGTTACGGCGACAGGGATTGGGATCTATTCGATTTATATGGCTGTTGTT
AATTATTTGACTGATGCTTATGAGCGTTATGCGGCATCGGCTTTGTCGGCTGCTTCGCTTGGGAGGAATACTTTT
GGTGCGTTCTTGCCGCTTGCTTCGCCGCAGTTGTTCTCCAATCTCGGGTATGGATGGGCGGGGACTTTGCTTGGG
TTTATTGGGATTGCGTTGTCTGTCGTGCCTGTTGTTTTGGTTTGGAAAGGCCCGGAGATTCGGAGGAGGAGCAAG
TTTATGAGGGAGGCGATGTGGGAGCCTTCGCAGAGGCCGGGCTAG
Gene >Pro_DTO377G3_2|g4756.t1
ATGTCTGATAAGGATAAAGATATCAAAATCCACACATGGGATGGGCCCGATGACCCCGAGAATCCCTTCAATTGG
AGCTTCAGATACAAATGGGTGATAACGATTACCGTTTGCTTCATGTAAGAAATGCCATCTCAACACAAAATACAT
AATTTTAAGCATCAAAATAACATCCTCACCAGCTCCATCCTGACAGGAATCCCCGCAGGAAGCTACGGCTCCGGC
AACGACTGGTTGAAGCAAGAATTCAATGTCCAAAACACCCCCTTCCCAAACCTCTACTGGGCCACCACTTCCTGG
AACATGGGCGCCGCCTTCTGGCCACTGATTTTCGTCCCTCTGACAGAGTCCTCCGGCCGCATGCCAGGATACTTC
GTGGCGTATATACTCCTCGTCATTTCGCTCTTCCCATCCGCGTTCGCAAAGAACTTCGCGACACTCATCGTGACT
CGGTTCTTCGGTGGAGGTGCTTCTTCCACCGCGATTAATATTGTCGGGGGAAGTATCTCCGATGTGTGGTTCGGT
AACGAGGCTCGCAGTCTGCCCATGTCTATATTCGGATTTACGAGTGTTGTCGGTATTTCACTTGGTCCATTTATT
GGATCTTCTATTGTGCAGATTCATAGATCACACCCATGGCGTTGGTAAGCACAACTTGCATTTCCGAATATCAAT
TTCCAAAATCCCATCATGCTGACCACCTCCCACGTAGGATCTTCTACATCCAAATTATCTACAACGCAGCCTTGA
TCCCGGTCTTTTGGCTAATACTCAAAGAAACCCGCCCAGAAGTGATCCTTAAGAAGCGCGCAAAGAAGATCCGCA
AAGAAACAAACCTCCCCATCTACGCCTCTTCCGAACTAGATGCCCCAAGCAAACTCAATCTCTTGAGACTCTCCT
TCCAACGCCCAACACACATGCTCATAGCCGAGCCGGTCGTGACCTTCTTCACTTTATGGATAAGTTTCGCCTGGG
GGATCCTGTTCCTCTTCTTTTCCAGCGTCGTGCAAACCTACTCCACAAACTACAACTGGGGTACGATGTCAACAG
GCCTGATACAGCTCGCCATCTCGGTGGGTGCGGTCATCGGGACAGTCATCAACCCGCTGCAGGACTGGATTCATC
TCCGCTCTGAGCGGCATAATAAAGAGAACCCGGGGAAACCTATCCCTGAGGCGAGACTGTACACATCTATCCCGG
GTAGTCTGCTATTTGCGGCGGGTTTGTTCTGGTACGGCTGGGCTAGTCAGCCGCATGTTCATTGGATCGTGCCGA
CTATCGGTGTTACGGCGACAGGGATTGGGATCTATTCGATTTATATGGCTGTTGTTAATTATTTGACTGATGCTT
ATGAGCGTTATGCGGCATCGGCTTTGTCGGCTGCTTCGCTTGGGAGGAATACTTTTGGTGCGTTCTTGCCGCTTG
CTTCGCCGCAGTTGTTCTCCAATCTCGGGTATGGATGGGCGGGGACTTTGCTTGGGTTTATTGGGATTGCGTTGT
CTGTCGTGCCTGTTGTTTTGGTTTGGAAAGGCCCGGAGATTCGGAGGAGGAGCAAGTTTATGAGGGAGGCGATGT
GGGAGCCTTCGCAGAGGCCGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail