Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4750.t1
Gene name
Locationscaffold_10:303552..304469
Strand-
Gene length (bp)917
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family 7.1E-30 28 216

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.70 0.33 5.07
5d_25C Five days - 25 degrees Celsius 6.19 1.61 10.77
7d_25C Seven days - 25 degrees Celsius 5.45 1.18 9.72
10d_25C Ten days - 25 degrees Celsius 5.80 1.45 10.14
7d_15C Seven days - 15 degrees Celsius 1.05 0.00 2.25
7d_30C Seven days - 30 degrees Celsius 12.29 4.17 20.40

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.066809 no
3d_25C 7d_25C 0.142948 no
3d_25C 7d_15C 0.125542 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.094279 no
5d_25C 7d_25C 0.833875 no
5d_25C 7d_15C 0.003625 yes
5d_25C 7d_30C 0.067447 no
5d_25C 10d_25C 0.918136 no
7d_25C 7d_15C 0.008469 yes
7d_25C 7d_30C 0.039770 yes
7d_25C 10d_25C 0.923975 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.008807 yes
7d_30C 10d_25C 0.041414 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4750.t1
MGSSYTNNLLQKTAKGQICKAFGIRLVTNPQVVQLAANSGYDALFIDLEHSTLSLNDASLLCMAGLGSGITPFVR
VPYQCGDGFVQRVLDGGAMGVIFPHIHNKDDALSAVSICKYPPTGKRSMTGQLPYFRLQSTPVGVFTQENNSNAS
SVFVMIETRESIDNVDEIASVDGIDVLLIGSNDLSTELGVPAQFKSDGFQSAVEAVSRACKKHGKTFGLAGIYEN
EELHDWALNKLGAGFILVQQDSGILARAGKDCANAITLLTGR*
Coding >Pro_DTO377G3_2|g4750.t1
ATGGGTTCCAGCTACACCAATAACCTGCTGCAGAAAACGGCGAAGGGCCAAATCTGCAAGGCATTCGGTATCCGG
CTAGTCACCAACCCCCAAGTGGTCCAGTTGGCGGCGAACAGTGGATACGATGCGCTCTTTATCGACCTAGAACAC
TCGACGCTATCTCTCAATGATGCAAGTCTGCTGTGTATGGCGGGCCTGGGTTCAGGTATCACACCCTTTGTCCGC
GTCCCCTACCAGTGTGGCGACGGCTTCGTGCAGCGCGTCTTGGATGGCGGTGCCATGGGAGTCATCTTTCCCCAT
ATTCATAACAAAGATGATGCCCTAAGCGCAGTGTCCATTTGCAAATATCCACCTACGGGGAAGAGGTCTATGACA
GGCCAGCTGCCATATTTCCGGCTTCAGTCGACGCCGGTCGGTGTTTTCACCCAGGAGAATAACTCCAATGCATCG
TCTGTTTTTGTGATGATTGAGACCCGGGAGAGCATCGATAATGTGGACGAGATTGCTTCCGTGGATGGGATAGAT
GTGCTGCTGATCGGCTCGAACGATTTATCTACGGAACTTGGGGTCCCTGCACAGTTCAAGAGCGATGGATTTCAG
TCGGCTGTGGAGGCCGTGAGTCGGGCCTGCAAGAAACATGGCAAGACATTCGGTCTTGCTGGTATCTACGAGAAT
GAAGAGCTGCATGACTGGGCTTTGAATAAGCTCGGAGCCGGTTTCATTCTGGTACAGCAAGACTCTGGCATCTTG
GCCCGAGCTGGGAAGGATTGTGCAAACGCTATTACATTGCTCACTGGTCGTTAG
Transcript >Pro_DTO377G3_2|g4750.t1
ATGGGTTCCAGCTACACCAATAACCTGCTGCAGAAAACGGCGAAGGGCCAAATCTGCAAGGCATTCGGTATCCGG
CTAGTCACCAACCCCCAAGTGGTCCAGTTGGCGGCGAACAGTGGATACGATGCGCTCTTTATCGACCTAGAACAC
TCGACGCTATCTCTCAATGATGCAAGTCTGCTGTGTATGGCGGGCCTGGGTTCAGGTATCACACCCTTTGTCCGC
GTCCCCTACCAGTGTGGCGACGGCTTCGTGCAGCGCGTCTTGGATGGCGGTGCCATGGGAGTCATCTTTCCCCAT
ATTCATAACAAAGATGATGCCCTAAGCGCAGTGTCCATTTGCAAATATCCACCTACGGGGAAGAGGTCTATGACA
GGCCAGCTGCCATATTTCCGGCTTCAGTCGACGCCGGTCGGTGTTTTCACCCAGGAGAATAACTCCAATGCATCG
TCTGTTTTTGTGATGATTGAGACCCGGGAGAGCATCGATAATGTGGACGAGATTGCTTCCGTGGATGGGATAGAT
GTGCTGCTGATCGGCTCGAACGATTTATCTACGGAACTTGGGGTCCCTGCACAGTTCAAGAGCGATGGATTTCAG
TCGGCTGTGGAGGCCGTGAGTCGGGCCTGCAAGAAACATGGCAAGACATTCGGTCTTGCTGGTATCTACGAGAAT
GAAGAGCTGCATGACTGGGCTTTGAATAAGCTCGGAGCCGGTTTCATTCTGGTACAGCAAGACTCTGGCATCTTG
GCCCGAGCTGGGAAGGATTGTGCAAACGCTATTACATTGCTCACTGGTCGTTAG
Gene >Pro_DTO377G3_2|g4750.t1
ATGGGTTCCAGCTACACCAATAACCTGCTGCAGAAAACGGCGAAGGGCCAAATCTGCAAGGCAAGTCTAATTTCC
AGTGACCGCTGTGTGATAATTATCTGTCTGCTAACTGGTGATAATAGGCATTCGGTATCCGGCTAGTCACCAACC
CCCAAGTGGTCCAGTTGGCGGCGAACAGTGGATACGATGCGCTCTTTATCGACCTAGAACACTCGACGCTATCTC
TCAATGATGCAAGTCTGCTGTGTATGGCGGGCCTGGGTTCAGGTATCACACCCTTTGTCCGCGTCCCCTACCAGT
GTGGCGACGGCTTCGTGCAGCGCGTCTTGGATGGCGGTGCCATGGGAGTCATCTTTCCCCATATTCATAACAAAG
GTAAGAAACATACCCTGATTTTCTTTCTTTTACTAATTTTCGCTTCCACAGATGATGCCCTAAGCGCAGTGTCCA
TTTGCAAATATCCACCTACGGGGAAGAGGTCTATGACAGGCCAGCTGCCATATTTCCGGCTTCAGTCGACGCCGG
TCGGTGTTTTCACCCAGGAGAATAACTCCAATGCATCGTCTGTTTTTGTGATGATTGAGACCCGGGAGAGCATCG
ATAATGTGGACGAGATTGCTTCCGTGGATGGGATAGATGTGCTGCTGATCGGCTCGAACGATTTATCTACGGAAC
TTGGGGTCCCTGCACAGTTCAAGAGCGATGGATTTCAGTCGGCTGTGGAGGCCGTGAGTCGGGCCTGCAAGAAAC
ATGGCAAGACATTCGGTCTTGCTGGTATCTACGAGAATGAAGAGCTGCATGACTGGGCTTTGAATAAGCTCGGAG
CCGGTTTCATTCTGGTACAGCAAGACTCTGGCATCTTGGCCCGAGCTGGGAAGGATTGTGCAAACGCTATTACAT
TGCTCACTGGTCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail