Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4740.t1
Gene name
Locationscaffold_10:265773..278013
Strand+
Gene length (bp)12240
Transcript length (bp)11814
Coding sequence length (bp)11814
Protein length (aa) 3938

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.0E-77 3012 3422
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.1E-72 3 253
PF00668 Condensation Condensation domain 2.7E-51 2548 2973
PF08659 KR KR domain 1.1E-47 2093 2267
PF14765 PS-DH Polyketide synthase dehydratase 5.8E-47 932 1229
PF00698 Acyl_transf_1 Acyl transferase domain 5.2E-46 544 860
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 9.0E-29 262 383
PF07993 NAD_binding_4 Male sterility protein 1.5E-25 3644 3809
PF00550 PP-binding Phosphopantetheine attachment site 3.6E-07 2387 2447
PF00550 PP-binding Phosphopantetheine attachment site 4.8E-10 3539 3604
PF08242 Methyltransf_12 Methyltransferase domain 1.0E-18 1409 1509
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 5.9E-17 396 504
PF13649 Methyltransf_25 Methyltransferase domain 2.0E-10 1407 1507
PF08241 Methyltransf_11 Methyltransferase domain 1.3E-09 1409 1510
PF00106 adh_short short chain dehydrogenase 2.9E-09 2097 2248
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.4E-09 3642 3800
PF13489 Methyltransf_23 Methyltransferase domain 4.6E-08 1390 1523
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.4E-06 1389 1517

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0048037 cofactor binding No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4740.t1
MPEPIAIIGTACRFPGGCDSPSKLWGLLRNPHDIAKKVPLERFNVDNFYHPEATHHGTTNATKSYFLEENIAQFD
APFFNIQPMESDAVDPQQRLLLETVYDSLCTAGLPMENLRGSSTAVYVGMMCDDWSTMVASDVETLPTYTATGLA
RSIVSNRISYVFDWHGPSMTIDTACSSSLVAVHHAVQTLRSGESSLAIAAGTNLILSPTMYVTETNLRMLSPNGR
CAMWDRAADGYARGEGVAAVVLKTLSRALADGDHIECIIRETGVNQDGRTTGLTMPSNTAQTALIRDTYRRAGLD
INEPHDRPQFFHAHGTGTQAGDPQEAEAVSAALFPNDSKDHTELFVGSIKTVIGHTEGSAGLASLIGSSLAMKHG
IVPPNLHFSELSDKVAPFYTNLKIPTEPMPWPKLAPGQVKRASINSFGFGGTNAHAIIESLEQDSERTLKLRSVA
NITPLVFSAASEKSLRNMLATYSVYLSANPTLDLHDLASTLSMRRSTLPFRTYVPVRSKEGLPKQLKTMADAAPN
ESELSVRRSQIINPAILGVFTGQGAQWPRMGACLIETSIFAQQKIAWLDSILQTLPAEDRPTWTIKEQLLAGSET
SRVTEAAVSQPLCLAIQVVLVDILHAAGVTFKAVVGHSSGEIGAAYAAGLLSAEDAVRIAYYRGLHAKHASSPNG
EKGAMMAVGASHVEALDMCADSRFKGRIQVAAVNSSSSITISGDEGTIDELLEVLKAEQRFARKLKVDTAYHSAH
MLPCAEPYLESMKSCGIQPEDRTGPVWLSSVTEGQRMAKEILTESYWVDNMCNTVLFSGAVAQAVLEAGPFDMTI
EIGPHPALKGPVTSTLEEFGCEAPYTGLLSRAKNDVHELSANLGFIWMHLGSGSIQFDTVDKLLSGFKGNREVLT
NLPSYPFDHQREYWTGSRVSNHHKFRRTPPNPLLGTQCSEANTAHEIQWRNILRPSEISWLSGHRLQGQVVFPAT
GYVSMAIEATKQLTIQNHITCIKIYDLEIGRAIAFGDDAASIEVVFNASVVEITEKAITAQFACYSISNADGNAV
LNAKGKVIADLGSSSPGTLASYESNPFNLVNVDPTEFYRYLTKIGYDYSEPFQGVSQIHRKPGYAIGLIEDQSGL
SWEDNLTFHPGVLDTALQTAFAAWSFPGDGQIWSLHVPTRFESLVFNPHFSPLALGKERSFKYETFIRTNTQGSL
TADIHLYTADGKNSCIQIEGASLVPFSPGSPKDDLPLFSSFKMRPAVPDGQLAAMGETISPYEAQVYKDIDRVAF
WYIRNVAQTITPEECDQILPHFRYYLRWCERMIGMVSRGEHPKVPVECLNDERKDITEVLSKYEGRKDIRFVEVV
GDHLVEVVRSGTSMLEYMNQDGLMLAVYENGLAAGPNNRWLSRIVAQIAHRYPGMHIFEIGAGTGASTKTILPEV
GSAFGTYTFTDVSSGFFPEAEERFKDYANRMIFKTFNTEFPPSDQGFTEGQYDVVIAANVLHVSADMERSMTNVR
RLLKPGGYLITLEVTNCDLLFSGMTVGTLPGWWVAAETGRPWGPCLTLPQWDSVLRQTGFSGIDTMTPDLSVSLP
VAVFVSQAIDDRVALLRDPLSLSTEDNLGTLVIIGGTTLPVFGIVEDVVTNLSSIFAEVMLFETVEELAIFGSAV
PNGASILCLTDLDEPFMKTLTPQKFTSLQKMFDVAGTLVLVSRGCRADEPYSMMLVGIGRTVKTENPKINLQLLD
IEAVEDTTANMLSEALLRHHLLRQWQSRKEPLLWSSEPEVVMQDRRALIPRLLPSTDKNQRYNSQRRAITKEVDP
RQATIQMIQNGVTFDVNDVSPLLISDAPSSKSITVRSILSSFQSLKIGSAGFLRLIYGVTSSSETVVALSCSTQS
PAVVPSKWCVPIAGHAMGHSPSSLLTTLAANIMAKEVLSSVPDGGVLLIREADEPFKSYLLHMAKELSVRTVFVT
SQGNTGTPDSFYIHPRLSQHKLKQLLPADVAVYADLSQGAGADDLSELLDKCLPSQCVHIKRSSLLNNDITDPHP
RFCDMISQLLQQTIETSTHSARTITIPLSRVSDHSVFEPFTVVDWSIQSVPVKVQPIDSGIIFRPDRTYFFVGLA
GELGQSLCQWMISHGAKYFVLSSRSPKVSPNFIEGMAQQGATVRTLPLDITSRRSLWSCYREISRTMPAVGGVIN
GAMILQDSVFENMTHEQFLKVIRPKVQGTILLDELFYDSPLEFFIVTSSITTAIGFSGQGNYSAANTFMTSLMYQ
RKKRGVPGSSMDIPAVHGIGYAAQEDNFDFEYFTTLGYNNVSEQDFCTLFAEAILSGRADSLDEAEVVSGVNYVS
PDLDIPQTHTRDIKFSHYILTAEEGSSVSGSKSAAQVRVQLQGVTSEEAIYDIVKDSFLVNLKKVLQISADDDID
LSTPLVEQGLDSLVAVMVRSWFLKEIEVDIPVLKILDGSSISDLLQLAVSKIPTSITCAEDPKSYTDTPSPSLPT
PAKPVFNSTISGTPSDSTPSYSPLLTPSESETSSIELLTPDEPLKSKELGATDKLARSQRDLVIQHSRLTREPMS
FGQARFWFLHHFLKSKTSFNFSTSARLVGPLRVTAFERALDTVIQRHEGLRTRFLWLDGDIGTPMQEIISHPLLK
LETKRIYSDAEAADELERLQNHEYDLEDWGSIRAMLLIFSDTVHYFLLGCHHIALDGQSMHILFSELDGLYNGKA
VPRIPDASQYRKFATRQKQDYESGLLQADIDFFRDIVREDPGAIEPFSFSHLSKRKILDTYRHHRASTRLGAGLA
RKVKQIARKLQSTNFHFYLTILQALVFRLLPYTNQFFVGIADANRVDKDSINTIGCLVNLLPLKFNRADSSKLDH
AVKLTRSKVYSALQHSRVPFDVLVNELEINRSAMHTPIFQIFMDYRLGDHENSRLVGCDAELSWNNAATGYDLHL
EVLDTVDEESLVVLKVQEGLYSKEAADLLLRAFTNLLEQATQSPADRIDLSSPLLWSRKDIDDALALGKGPELNP
EWPSTVAHRVDEMVDAHPDVIAIKDGHGHALTYSAMADRVNTIAATLLEYVSGGDSVAVFQEPSADWICSLLAIF
RVGAAYVPLDLKNGLQRLAGAVEVASPRVILHDKFTEARVPDLRVARAAIVNVSDIDMNPDAKVPNRAMAESTAA
ILFTSGSTGVPKGIVLPHSCFATHVEAVEKAWGVGAAVVLQQIALSFDFSLHQIFTALANGGTLFVVPYEKRGDP
YEITKIMKQEGVTHTLATPTEYGMWFDAGADILSQCSSWKWALVGGEALPKSIVRRFRDLNSSNLKLFDFYGPVE
ATIALTKGEVNFGLADTEQPIPVGRLLPNYSVYILDEALQPLPIGVPGEIVVGGPGVAAGYLGQEELTNEKFIPV
PSYLQDERSKKLGWNRLYRTGDRGRLNNDGTLIYEGRINGDDQIKLRGIRIELGEIENAIIEVANGKVSQAVVAV
HGEEADKFLVAYVVLSSHGEKSGDNLFTAIKAALPLPSYMRPSLFIPIHSVPMNVHGKTDRKALYNIPLPDIVTS
GPSERGLMNFQEKKLCGLWEEILPAYGAVISSGTDFFHVGGNSLLLVKLQRRLKEAFAFSPRLADLMNSSTLSDM
ARLLEDTDASVVDWEAETSVPASWADLAQSATPSAPNDRMTVLLTGATGYIGRHLLSSLLESTRVSRIICLVRDK
SKLVTESEKVVAISCAFDKPNLGLTSDELSYLTHNADIVVHCAANRSFWDDYQALRAVNFYSVRDIARLCLPRRL
PLHFFSSGAVADQADLADSHDGYLTSKWAAEKFLHNVSQEFGLPVHIHSPSAATADTPYTVDSIVQQDFIECAQR
VGARPDLEGTSGHMDLSQTTGFIATASEAILNGREDIDNNAPILRRVVYNPTQRFDIQRSTSSIGADPRWASLPT
MDMLQWMGKAKQNGFPYVLTAQHIVIGSKTGQVVSRR*
Coding >Pro_DTO377G3_2|g4740.t1
ATGCCTGAACCAATTGCCATCATCGGAACCGCCTGTCGCTTTCCCGGCGGGTGCGATAGCCCCAGCAAACTCTGG
GGGCTATTGAGAAACCCTCACGACATTGCCAAAAAGGTTCCTCTGGAGCGCTTCAATGTTGATAATTTCTACCAC
CCCGAGGCAACTCACCATGGCACCACGAACGCTACCAAGTCCTACTTTCTTGAGGAGAACATCGCTCAGTTCGAT
GCGCCGTTCTTCAATATACAACCGATGGAGAGCGATGCTGTTGATCCGCAGCAACGTCTACTCCTAGAGACTGTG
TATGACTCCCTGTGCACCGCGGGTCTGCCCATGGAGAACCTCCGCGGCTCGTCTACGGCTGTCTACGTTGGTATG
ATGTGCGATGATTGGTCCACCATGGTGGCGAGCGATGTCGAGACCTTGCCAACCTATACGGCTACCGGCTTAGCT
CGAAGTATTGTGTCCAACCGGATCTCGTATGTCTTTGACTGGCATGGCCCTTCGATGACCATCGATACGGCATGC
TCGTCGAGTCTTGTTGCCGTGCACCACGCCGTGCAGACCTTGCGTAGTGGTGAATCTTCCTTGGCCATAGCCGCT
GGAACCAACTTGATTCTAAGTCCTACCATGTACGTAACCGAGACGAACCTGCGAATGTTGTCGCCGAATGGACGG
TGCGCGATGTGGGATCGGGCTGCCGATGGCTATGCTCGTGGCGAGGGAGTCGCCGCTGTAGTCTTAAAGACCTTG
AGCCGAGCTCTGGCCGATGGAGACCACATAGAGTGCATCATTCGTGAGACTGGAGTGAATCAGGATGGTCGCACT
ACCGGACTCACCATGCCGAGTAACACCGCGCAAACGGCGTTAATCCGCGACACGTACCGCCGAGCGGGGCTGGAC
ATCAATGAACCTCACGATCGCCCTCAATTCTTCCATGCCCACGGAACTGGCACCCAGGCCGGTGACCCTCAAGAA
GCGGAGGCTGTCTCGGCAGCTCTATTTCCCAATGACTCGAAGGACCACACAGAGCTCTTTGTGGGGTCAATCAAG
ACTGTGATTGGGCACACTGAAGGCTCTGCTGGTCTGGCCTCTTTGATTGGGTCCTCGCTGGCTATGAAGCATGGA
ATCGTACCGCCTAATCTTCACTTTAGCGAATTGAGCGACAAAGTCGCGCCGTTTTATACGAATCTGAAGATCCCA
ACAGAGCCCATGCCTTGGCCGAAGCTGGCTCCCGGTCAAGTCAAACGGGCCAGTATCAATAGTTTTGGTTTTGGT
GGAACCAATGCCCACGCCATCATCGAGAGTCTCGAGCAAGATTCCGAAAGAACATTGAAGCTTCGTTCGGTCGCA
AATATCACTCCACTGGTTTTTTCTGCAGCTTCCGAAAAGAGCCTTCGGAATATGCTCGCCACGTATTCAGTCTAC
CTGTCCGCCAACCCTACGTTAGATCTCCATGATCTGGCCAGTACGCTCAGCATGCGCCGATCGACACTACCCTTT
CGAACTTACGTTCCAGTCCGTAGCAAGGAAGGGCTACCCAAGCAGTTGAAGACCATGGCGGATGCCGCCCCAAAT
GAGTCGGAGCTCAGCGTTCGCCGCTCTCAGATCATTAACCCAGCTATTCTTGGCGTGTTCACCGGGCAGGGAGCG
CAGTGGCCACGGATGGGAGCGTGTCTCATCGAGACCTCAATTTTCGCCCAACAGAAAATTGCCTGGCTCGACTCA
ATTCTTCAAACCTTACCTGCAGAGGACCGCCCGACCTGGACGATCAAGGAGCAGCTGCTTGCTGGTAGCGAGACT
TCCCGGGTGACAGAAGCGGCAGTATCGCAGCCCCTGTGCCTTGCTATTCAGGTGGTATTGGTTGATATCCTCCAC
GCTGCGGGCGTTACATTCAAAGCTGTCGTGGGCCACTCATCCGGTGAGATCGGAGCTGCGTACGCTGCGGGTCTC
CTGTCGGCCGAGGATGCCGTTAGGATCGCATACTACCGTGGCCTGCACGCAAAACATGCATCATCACCGAACGGC
GAGAAGGGTGCCATGATGGCTGTTGGCGCTTCGCATGTAGAAGCCCTGGACATGTGCGCCGACTCACGCTTCAAA
GGCCGCATTCAGGTCGCGGCAGTGAATTCTAGCTCCAGTATTACAATTTCAGGTGACGAAGGCACTATTGATGAG
CTCCTTGAGGTACTCAAAGCCGAGCAGAGGTTTGCGAGGAAGCTGAAGGTTGACACCGCCTATCACTCGGCGCAC
ATGCTACCCTGTGCAGAGCCTTACTTGGAGTCCATGAAGTCGTGCGGAATACAGCCAGAAGACCGGACAGGGCCT
GTATGGCTTTCTAGTGTTACCGAGGGACAGAGAATGGCCAAGGAAATTCTCACTGAAAGCTACTGGGTTGATAAC
ATGTGCAACACGGTATTATTCTCTGGCGCAGTGGCTCAGGCTGTTTTGGAGGCTGGGCCATTCGACATGACCATT
GAAATCGGTCCGCACCCGGCACTCAAGGGTCCGGTAACATCGACGCTTGAGGAGTTTGGATGTGAAGCCCCCTAC
ACAGGTCTGCTATCCCGAGCCAAAAACGATGTTCACGAACTATCCGCAAACCTCGGTTTCATCTGGATGCATCTT
GGGTCCGGCAGCATTCAGTTTGACACTGTCGACAAGCTTCTATCTGGGTTCAAAGGAAACAGGGAAGTCCTCACC
AACTTGCCGTCATATCCCTTCGACCATCAGCGTGAATACTGGACTGGGTCCCGCGTGTCTAATCACCACAAATTT
CGTCGAACCCCTCCAAACCCACTGCTCGGGACGCAATGTTCCGAAGCGAACACTGCCCATGAGATTCAATGGAGA
AATATCCTTCGCCCGAGCGAGATCTCTTGGCTCAGTGGGCATCGTCTGCAGGGTCAAGTGGTTTTCCCAGCCACG
GGTTACGTCTCTATGGCCATTGAAGCGACGAAGCAGCTCACTATTCAGAATCATATTACTTGCATCAAGATTTAC
GATCTGGAAATAGGTCGCGCAATTGCTTTCGGCGATGATGCAGCCAGTATCGAGGTCGTCTTTAATGCAAGCGTG
GTCGAGATAACCGAGAAAGCCATCACCGCCCAGTTCGCTTGTTACTCAATTTCCAATGCCGATGGAAATGCAGTC
CTGAATGCGAAAGGCAAGGTCATTGCAGATTTGGGTAGCTCTAGTCCAGGGACACTTGCAAGTTACGAGTCCAAC
CCTTTCAATCTGGTCAATGTTGACCCAACTGAGTTTTACCGGTACCTCACTAAGATTGGCTATGATTACTCCGAG
CCCTTCCAAGGCGTGTCGCAGATTCACCGCAAGCCTGGATATGCTATCGGTCTGATCGAGGACCAGTCTGGCCTC
TCATGGGAGGATAATCTCACATTTCATCCGGGAGTCCTTGATACTGCTCTACAAACCGCTTTCGCGGCATGGTCC
TTTCCTGGTGATGGTCAGATCTGGTCCCTTCATGTTCCCACTCGGTTTGAGTCGCTAGTTTTCAACCCTCACTTC
TCCCCTCTTGCCCTAGGCAAAGAACGCTCCTTCAAATACGAAACATTCATTCGCACTAATACCCAAGGAAGCCTG
ACTGCCGATATTCACTTGTACACCGCAGATGGCAAGAACTCATGCATCCAGATTGAAGGTGCATCCCTTGTTCCA
TTCTCACCGGGCTCTCCTAAAGACGATCTGCCACTCTTTTCAAGTTTCAAGATGAGACCTGCTGTTCCTGATGGG
CAACTTGCGGCAATGGGCGAGACGATTTCACCCTACGAAGCGCAGGTTTACAAGGACATTGATCGTGTCGCTTTC
TGGTATATCCGAAATGTGGCCCAGACTATTACCCCAGAAGAGTGTGATCAGATTCTGCCCCATTTCAGATACTAT
CTGCGGTGGTGTGAGCGCATGATTGGCATGGTCTCTCGGGGTGAACATCCCAAGGTCCCCGTTGAATGTCTTAAT
GATGAGAGAAAAGACATCACTGAAGTGTTGAGCAAGTATGAGGGCCGCAAAGATATCCGATTTGTTGAGGTGGTC
GGCGACCACCTTGTTGAAGTCGTCCGCAGTGGCACTAGCATGCTAGAGTATATGAACCAGGATGGGCTGATGCTC
GCGGTTTACGAAAATGGTCTGGCAGCCGGGCCAAACAACCGCTGGCTGAGTCGCATCGTCGCCCAAATTGCGCAT
CGCTATCCGGGAATGCATATTTTCGAGATCGGAGCCGGAACGGGCGCATCCACCAAGACAATTTTGCCCGAAGTC
GGCTCAGCCTTTGGAACGTATACTTTCACTGACGTGTCTAGTGGTTTCTTCCCTGAAGCTGAGGAGCGCTTCAAG
GACTATGCCAACCGTATGATCTTCAAGACGTTCAACACTGAGTTCCCGCCAAGCGATCAGGGATTCACTGAAGGC
CAGTACGATGTGGTTATTGCTGCAAATGTTCTTCATGTCTCGGCCGACATGGAGCGATCCATGACAAATGTCCGC
CGACTATTGAAACCCGGTGGTTACTTGATTACCTTAGAGGTGACAAATTGTGACCTTCTCTTCAGCGGTATGACC
GTGGGAACTCTCCCAGGTTGGTGGGTGGCTGCGGAGACTGGACGACCGTGGGGTCCTTGCTTGACGCTGCCTCAG
TGGGACTCTGTACTCCGGCAAACAGGCTTCTCGGGCATTGATACTATGACACCCGATCTCAGTGTATCTCTTCCC
GTCGCGGTCTTTGTTTCCCAGGCCATTGATGATCGAGTTGCTCTCCTTCGAGACCCTCTTTCATTGTCGACCGAG
GATAATTTGGGCACTCTGGTCATCATCGGCGGCACGACGCTACCAGTCTTCGGTATTGTGGAAGATGTTGTGACT
AATCTATCCTCTATATTTGCTGAGGTCATGCTGTTTGAGACTGTTGAAGAGTTGGCAATCTTTGGCTCCGCGGTA
CCTAATGGGGCCAGCATTCTCTGTCTAACTGATCTCGATGAACCATTTATGAAGACATTGACGCCGCAGAAGTTT
ACCAGCTTACAGAAAATGTTCGACGTGGCGGGAACCTTGGTGTTGGTTTCTCGTGGCTGCAGAGCAGATGAACCA
TATTCCATGATGCTTGTGGGCATCGGGCGGACAGTCAAGACCGAAAATCCGAAAATCAACCTTCAACTACTTGAC
ATTGAAGCCGTTGAGGACACAACGGCCAACATGCTGTCTGAAGCTCTGCTTAGACACCATCTTCTGAGGCAATGG
CAGTCTAGGAAAGAACCCCTTCTCTGGTCCTCAGAGCCGGAGGTTGTTATGCAAGACAGACGCGCACTCATTCCG
AGGCTCTTGCCCAGCACAGACAAGAATCAGCGTTACAACTCCCAGAGACGCGCTATAACCAAGGAGGTCGACCCT
AGACAGGCAACCATACAGATGATCCAGAATGGAGTCACATTCGACGTCAATGATGTTTCGCCACTGCTAATTTCC
GATGCACCATCGTCGAAATCCATTACAGTTCGCAGCATTCTTTCCTCATTCCAGTCTCTCAAAATTGGAAGCGCC
GGTTTCCTCCGTCTCATCTACGGTGTGACTTCTTCGTCTGAGACAGTTGTCGCCCTTTCATGCTCCACTCAGTCC
CCAGCAGTTGTACCATCCAAGTGGTGTGTACCAATTGCAGGCCATGCTATGGGTCATAGCCCATCATCACTCCTT
ACAACTTTGGCTGCCAATATCATGGCGAAGGAGGTTCTGAGCTCTGTGCCGGATGGTGGAGTTCTTCTGATACGG
GAGGCAGATGAGCCTTTCAAGTCTTATCTTTTGCACATGGCAAAAGAATTGAGTGTCAGAACGGTTTTTGTTACC
AGTCAGGGCAACACGGGTACCCCTGACAGCTTCTATATCCACCCCAGACTTTCGCAGCATAAATTGAAGCAGCTC
CTTCCTGCAGATGTTGCCGTCTACGCTGATCTATCCCAGGGGGCTGGAGCAGATGATTTATCAGAACTACTTGAT
AAGTGTCTCCCATCTCAATGCGTCCATATCAAACGAAGCTCTCTTCTCAATAATGATATCACTGATCCTCATCCC
CGTTTTTGTGACATGATCAGTCAACTTCTTCAGCAAACAATTGAAACTTCCACGCATTCTGCAAGAACTATCACC
ATTCCGCTTAGCAGAGTGTCCGATCATTCTGTGTTTGAGCCTTTTACCGTGGTTGACTGGTCAATTCAATCCGTT
CCGGTCAAAGTTCAGCCAATCGATTCTGGCATCATCTTCAGGCCGGATCGAACATACTTCTTCGTTGGTCTAGCT
GGCGAGCTGGGTCAGTCCTTGTGCCAATGGATGATTTCTCATGGAGCCAAGTATTTTGTCTTGAGTAGTCGGTCT
CCAAAGGTCAGCCCGAATTTTATTGAGGGGATGGCGCAGCAGGGAGCGACAGTCAGAACATTGCCGTTAGATATT
ACAAGCCGAAGGTCCCTTTGGTCCTGCTACCGAGAGATCAGCCGCACCATGCCCGCCGTTGGCGGCGTCATCAAC
GGTGCCATGATCCTCCAAGACAGCGTTTTCGAAAACATGACCCATGAACAATTCCTCAAAGTGATCAGACCAAAG
GTCCAAGGCACCATACTCTTGGACGAACTATTCTATGACTCACCCCTAGAATTCTTCATCGTCACTTCCTCCATC
ACCACAGCCATCGGTTTCAGCGGACAGGGTAACTACTCGGCGGCGAACACGTTCATGACCTCTCTCATGTACCAG
CGCAAGAAGAGGGGGGTTCCTGGCTCCTCTATGGACATCCCGGCTGTTCACGGTATTGGATATGCCGCCCAAGAG
GATAACTTTGACTTTGAGTATTTCACTACACTCGGCTACAACAATGTTTCTGAGCAAGACTTCTGCACACTTTTT
GCAGAGGCTATTCTCTCCGGTCGCGCCGACTCCCTTGATGAGGCTGAGGTTGTATCAGGTGTTAATTATGTGTCG
CCCGACTTGGATATCCCCCAGACTCACACCAGAGATATCAAATTCTCCCATTACATCCTGACCGCGGAAGAAGGA
TCCAGCGTCAGCGGTAGCAAGTCCGCCGCGCAGGTGAGGGTACAGTTGCAGGGAGTGACAAGCGAAGAGGCAATC
TATGATATTGTCAAAGATTCCTTCCTGGTGAATCTCAAAAAAGTTCTCCAGATCTCAGCTGATGATGATATTGAT
CTTTCAACGCCTCTTGTGGAGCAGGGGCTGGACTCACTTGTGGCTGTAATGGTTCGCTCGTGGTTTTTGAAAGAG
ATCGAGGTCGATATTCCGGTTCTGAAGATCCTTGACGGCAGCTCTATTTCTGATCTTCTTCAACTGGCCGTTTCC
AAGATACCTACATCTATCACTTGTGCAGAGGACCCGAAAAGCTACACTGACACTCCAAGCCCATCGTTACCAACA
CCTGCCAAACCCGTCTTCAATAGTACCATTTCTGGAACACCTAGCGACTCTACACCCAGCTACTCACCACTGCTG
ACACCTAGTGAAAGCGAGACATCATCCATTGAGCTGCTGACTCCAGATGAGCCCCTTAAATCCAAGGAACTAGGG
GCCACAGATAAACTGGCCCGATCGCAACGGGACTTGGTCATTCAGCATTCCCGCCTCACGAGAGAGCCCATGTCC
TTTGGGCAAGCCAGATTCTGGTTCCTCCATCATTTCTTGAAGAGCAAAACGTCCTTCAACTTTTCGACTTCTGCA
CGTCTGGTGGGCCCGCTGCGAGTGACGGCCTTTGAGCGAGCTTTGGACACAGTGATTCAGCGACACGAAGGTCTA
CGTACTAGATTCCTCTGGTTGGATGGGGATATTGGCACACCTATGCAGGAGATTATCTCTCACCCTCTGCTTAAA
TTGGAGACCAAGCGCATATACTCCGATGCTGAGGCAGCCGACGAACTAGAGAGGTTGCAAAATCACGAATATGAT
CTGGAAGACTGGGGGTCTATCAGAGCAATGCTTCTTATTTTTTCCGACACCGTCCACTACTTCCTCCTTGGATGT
CATCATATTGCCTTGGATGGACAAAGTATGCACATTCTTTTCTCGGAGCTCGACGGTTTGTATAACGGTAAAGCT
GTTCCTCGAATCCCCGATGCCTCGCAATACCGAAAGTTTGCTACCAGACAGAAACAAGATTACGAATCTGGGCTA
TTGCAGGCTGACATCGATTTCTTCCGTGACATCGTCCGTGAGGATCCGGGTGCGATTGAGCCGTTCTCGTTCTCG
CACCTCTCAAAGCGGAAGATTCTAGATACCTACCGGCACCATCGCGCGTCGACCCGGCTGGGAGCCGGGTTAGCT
CGCAAGGTCAAGCAAATTGCCCGCAAGCTTCAGAGCACGAATTTTCATTTCTACCTGACTATTCTTCAAGCGCTC
GTATTCCGCCTACTTCCCTATACCAACCAATTCTTTGTCGGAATTGCGGACGCGAACCGAGTGGATAAAGATTCA
ATCAACACGATCGGTTGCCTCGTGAATCTACTGCCGCTCAAGTTCAACCGGGCGGACTCATCCAAACTCGATCAT
GCCGTCAAACTCACACGGAGCAAGGTGTACTCTGCTCTCCAGCACTCGCGAGTGCCATTCGATGTTCTTGTCAAT
GAGCTCGAGATCAACCGTTCCGCCATGCACACCCCAATCTTCCAAATCTTCATGGACTACCGGCTAGGCGACCAC
GAGAACTCGCGGCTAGTCGGTTGCGATGCCGAGCTTTCGTGGAATAATGCTGCTACAGGGTATGATTTGCACCTG
GAGGTGCTTGATACTGTCGATGAAGAGTCGCTCGTTGTTTTGAAAGTGCAAGAGGGTCTCTATTCCAAGGAAGCA
GCGGACTTGCTGCTTCGTGCTTTCACCAATCTCCTAGAACAGGCCACACAAAGTCCTGCCGATCGTATCGATCTA
TCGTCGCCTCTGCTGTGGTCTAGAAAGGATATTGATGATGCGTTAGCGTTGGGAAAGGGTCCGGAACTGAACCCT
GAATGGCCATCGACGGTCGCACACCGCGTTGATGAGATGGTGGATGCACACCCTGATGTCATAGCTATCAAGGAT
GGACATGGACATGCCCTCACCTATAGTGCCATGGCCGACCGCGTTAACACGATCGCTGCTACCCTCCTTGAATAT
GTCTCTGGTGGCGATAGTGTTGCCGTGTTCCAAGAGCCAAGCGCTGACTGGATCTGTTCGCTACTCGCCATCTTC
CGTGTTGGGGCGGCGTATGTCCCCTTGGATCTGAAGAATGGTCTGCAACGGCTTGCGGGTGCTGTTGAAGTTGCC
AGCCCGCGGGTTATCCTCCACGATAAATTCACAGAGGCTCGAGTGCCGGATCTTCGGGTGGCAAGGGCAGCTATC
GTCAATGTCTCCGATATTGACATGAACCCCGATGCCAAAGTACCGAACAGGGCCATGGCAGAGTCCACTGCGGCT
ATTCTGTTCACTAGCGGGTCGACGGGTGTTCCCAAGGGCATCGTACTACCGCATTCTTGCTTCGCGACGCATGTC
GAAGCTGTCGAAAAAGCCTGGGGCGTGGGCGCGGCGGTAGTCCTCCAACAAATTGCCCTCAGTTTTGACTTTTCC
TTGCATCAGATCTTCACGGCCCTTGCCAACGGGGGAACCCTCTTTGTGGTCCCGTACGAGAAACGCGGAGACCCG
TATGAAATCACCAAGATCATGAAGCAAGAAGGAGTCACCCACACCCTGGCCACCCCAACCGAATATGGTATGTGG
TTCGATGCAGGGGCGGACATTCTCTCCCAGTGCTCTTCCTGGAAATGGGCTCTTGTCGGTGGCGAAGCCTTGCCA
AAGTCAATTGTTCGACGCTTCCGGGATTTGAACTCGAGTAATCTCAAGCTCTTCGATTTCTATGGACCTGTAGAG
GCCACTATTGCACTTACCAAAGGCGAGGTCAATTTCGGGCTCGCTGATACTGAACAACCAATTCCGGTTGGAAGG
CTTCTTCCCAACTACTCTGTCTACATTCTAGACGAAGCGCTGCAGCCTCTCCCGATCGGTGTCCCGGGGGAGATT
GTTGTTGGCGGACCCGGAGTGGCGGCAGGTTACCTTGGCCAAGAAGAGCTCACAAACGAGAAGTTTATCCCCGTC
CCTAGCTACTTGCAGGACGAACGCTCCAAGAAGCTTGGATGGAACAGATTATATCGGACCGGTGACCGTGGACGC
CTGAACAACGACGGCACTCTCATATATGAGGGTCGGATCAACGGTGACGATCAGATCAAGCTTCGTGGCATTCGC
ATTGAGCTGGGGGAGATCGAAAATGCTATTATCGAGGTCGCGAACGGCAAAGTCTCTCAGGCGGTTGTTGCTGTC
CATGGCGAAGAGGCTGACAAATTTTTGGTGGCTTATGTTGTCCTTTCATCGCATGGTGAAAAGTCCGGTGACAAT
CTTTTCACAGCCATCAAAGCAGCACTCCCCCTTCCCAGCTATATGCGACCTTCGCTATTCATTCCCATTCACAGT
GTCCCGATGAACGTGCATGGAAAGACTGATCGCAAGGCTCTTTACAATATTCCTTTGCCGGATATCGTGACTTCG
GGTCCCTCTGAGCGAGGTCTGATGAATTTCCAAGAAAAGAAACTCTGTGGATTATGGGAAGAGATCTTGCCAGCA
TATGGTGCCGTAATCAGCTCAGGGACAGACTTCTTCCATGTTGGAGGAAACTCGCTGTTGCTTGTCAAACTTCAA
CGCCGCCTCAAGGAAGCCTTTGCGTTTTCTCCACGACTCGCTGATCTCATGAACTCTAGTACATTGAGCGATATG
GCCCGCCTTCTAGAGGACACGGATGCGAGTGTGGTCGATTGGGAGGCTGAAACATCTGTGCCGGCATCATGGGCT
GATCTCGCACAGAGTGCCACGCCGTCTGCCCCAAATGACAGAATGACGGTCCTTTTGACGGGCGCAACTGGTTAT
ATCGGCCGTCATCTCCTCTCCTCTCTTCTTGAAAGCACCCGTGTGTCCAGAATCATCTGCCTTGTCCGTGACAAA
AGCAAGCTAGTCACAGAATCTGAGAAAGTCGTGGCAATCTCCTGCGCTTTCGACAAGCCCAATCTTGGGCTCACC
TCCGATGAGCTTAGCTATCTGACTCACAATGCCGACATCGTGGTGCATTGTGCTGCCAATCGATCCTTCTGGGAT
GACTACCAGGCACTGAGAGCCGTGAACTTCTATTCCGTCCGTGACATCGCCCGTCTGTGTCTTCCGCGCCGCTTG
CCGCTTCACTTCTTTTCTTCCGGCGCTGTCGCCGACCAAGCGGATCTCGCGGATTCACACGATGGCTATTTGACA
AGCAAATGGGCAGCCGAAAAGTTCCTTCACAATGTATCTCAGGAGTTTGGTTTGCCGGTGCATATCCACAGTCCA
AGCGCAGCAACTGCAGACACGCCGTACACAGTCGACTCCATCGTCCAACAAGACTTTATCGAATGTGCACAGCGT
GTCGGTGCACGGCCCGATCTCGAGGGTACGTCCGGCCATATGGATCTCAGTCAGACGACCGGCTTCATCGCGACA
GCATCGGAGGCCATTCTTAACGGGCGTGAAGACATCGATAACAATGCTCCCATACTCAGGAGGGTGGTATATAAC
CCCACCCAACGGTTCGATATCCAGCGCTCCACTTCTTCTATCGGTGCTGATCCCAGATGGGCGTCACTGCCGACG
ATGGATATGCTGCAGTGGATGGGGAAGGCAAAGCAGAATGGGTTCCCGTATGTGCTGACGGCCCAGCATATTGTG
ATCGGTTCGAAGACGGGACAGGTGGTATCTAGGCGATAG
Transcript >Pro_DTO377G3_2|g4740.t1
ATGCCTGAACCAATTGCCATCATCGGAACCGCCTGTCGCTTTCCCGGCGGGTGCGATAGCCCCAGCAAACTCTGG
GGGCTATTGAGAAACCCTCACGACATTGCCAAAAAGGTTCCTCTGGAGCGCTTCAATGTTGATAATTTCTACCAC
CCCGAGGCAACTCACCATGGCACCACGAACGCTACCAAGTCCTACTTTCTTGAGGAGAACATCGCTCAGTTCGAT
GCGCCGTTCTTCAATATACAACCGATGGAGAGCGATGCTGTTGATCCGCAGCAACGTCTACTCCTAGAGACTGTG
TATGACTCCCTGTGCACCGCGGGTCTGCCCATGGAGAACCTCCGCGGCTCGTCTACGGCTGTCTACGTTGGTATG
ATGTGCGATGATTGGTCCACCATGGTGGCGAGCGATGTCGAGACCTTGCCAACCTATACGGCTACCGGCTTAGCT
CGAAGTATTGTGTCCAACCGGATCTCGTATGTCTTTGACTGGCATGGCCCTTCGATGACCATCGATACGGCATGC
TCGTCGAGTCTTGTTGCCGTGCACCACGCCGTGCAGACCTTGCGTAGTGGTGAATCTTCCTTGGCCATAGCCGCT
GGAACCAACTTGATTCTAAGTCCTACCATGTACGTAACCGAGACGAACCTGCGAATGTTGTCGCCGAATGGACGG
TGCGCGATGTGGGATCGGGCTGCCGATGGCTATGCTCGTGGCGAGGGAGTCGCCGCTGTAGTCTTAAAGACCTTG
AGCCGAGCTCTGGCCGATGGAGACCACATAGAGTGCATCATTCGTGAGACTGGAGTGAATCAGGATGGTCGCACT
ACCGGACTCACCATGCCGAGTAACACCGCGCAAACGGCGTTAATCCGCGACACGTACCGCCGAGCGGGGCTGGAC
ATCAATGAACCTCACGATCGCCCTCAATTCTTCCATGCCCACGGAACTGGCACCCAGGCCGGTGACCCTCAAGAA
GCGGAGGCTGTCTCGGCAGCTCTATTTCCCAATGACTCGAAGGACCACACAGAGCTCTTTGTGGGGTCAATCAAG
ACTGTGATTGGGCACACTGAAGGCTCTGCTGGTCTGGCCTCTTTGATTGGGTCCTCGCTGGCTATGAAGCATGGA
ATCGTACCGCCTAATCTTCACTTTAGCGAATTGAGCGACAAAGTCGCGCCGTTTTATACGAATCTGAAGATCCCA
ACAGAGCCCATGCCTTGGCCGAAGCTGGCTCCCGGTCAAGTCAAACGGGCCAGTATCAATAGTTTTGGTTTTGGT
GGAACCAATGCCCACGCCATCATCGAGAGTCTCGAGCAAGATTCCGAAAGAACATTGAAGCTTCGTTCGGTCGCA
AATATCACTCCACTGGTTTTTTCTGCAGCTTCCGAAAAGAGCCTTCGGAATATGCTCGCCACGTATTCAGTCTAC
CTGTCCGCCAACCCTACGTTAGATCTCCATGATCTGGCCAGTACGCTCAGCATGCGCCGATCGACACTACCCTTT
CGAACTTACGTTCCAGTCCGTAGCAAGGAAGGGCTACCCAAGCAGTTGAAGACCATGGCGGATGCCGCCCCAAAT
GAGTCGGAGCTCAGCGTTCGCCGCTCTCAGATCATTAACCCAGCTATTCTTGGCGTGTTCACCGGGCAGGGAGCG
CAGTGGCCACGGATGGGAGCGTGTCTCATCGAGACCTCAATTTTCGCCCAACAGAAAATTGCCTGGCTCGACTCA
ATTCTTCAAACCTTACCTGCAGAGGACCGCCCGACCTGGACGATCAAGGAGCAGCTGCTTGCTGGTAGCGAGACT
TCCCGGGTGACAGAAGCGGCAGTATCGCAGCCCCTGTGCCTTGCTATTCAGGTGGTATTGGTTGATATCCTCCAC
GCTGCGGGCGTTACATTCAAAGCTGTCGTGGGCCACTCATCCGGTGAGATCGGAGCTGCGTACGCTGCGGGTCTC
CTGTCGGCCGAGGATGCCGTTAGGATCGCATACTACCGTGGCCTGCACGCAAAACATGCATCATCACCGAACGGC
GAGAAGGGTGCCATGATGGCTGTTGGCGCTTCGCATGTAGAAGCCCTGGACATGTGCGCCGACTCACGCTTCAAA
GGCCGCATTCAGGTCGCGGCAGTGAATTCTAGCTCCAGTATTACAATTTCAGGTGACGAAGGCACTATTGATGAG
CTCCTTGAGGTACTCAAAGCCGAGCAGAGGTTTGCGAGGAAGCTGAAGGTTGACACCGCCTATCACTCGGCGCAC
ATGCTACCCTGTGCAGAGCCTTACTTGGAGTCCATGAAGTCGTGCGGAATACAGCCAGAAGACCGGACAGGGCCT
GTATGGCTTTCTAGTGTTACCGAGGGACAGAGAATGGCCAAGGAAATTCTCACTGAAAGCTACTGGGTTGATAAC
ATGTGCAACACGGTATTATTCTCTGGCGCAGTGGCTCAGGCTGTTTTGGAGGCTGGGCCATTCGACATGACCATT
GAAATCGGTCCGCACCCGGCACTCAAGGGTCCGGTAACATCGACGCTTGAGGAGTTTGGATGTGAAGCCCCCTAC
ACAGGTCTGCTATCCCGAGCCAAAAACGATGTTCACGAACTATCCGCAAACCTCGGTTTCATCTGGATGCATCTT
GGGTCCGGCAGCATTCAGTTTGACACTGTCGACAAGCTTCTATCTGGGTTCAAAGGAAACAGGGAAGTCCTCACC
AACTTGCCGTCATATCCCTTCGACCATCAGCGTGAATACTGGACTGGGTCCCGCGTGTCTAATCACCACAAATTT
CGTCGAACCCCTCCAAACCCACTGCTCGGGACGCAATGTTCCGAAGCGAACACTGCCCATGAGATTCAATGGAGA
AATATCCTTCGCCCGAGCGAGATCTCTTGGCTCAGTGGGCATCGTCTGCAGGGTCAAGTGGTTTTCCCAGCCACG
GGTTACGTCTCTATGGCCATTGAAGCGACGAAGCAGCTCACTATTCAGAATCATATTACTTGCATCAAGATTTAC
GATCTGGAAATAGGTCGCGCAATTGCTTTCGGCGATGATGCAGCCAGTATCGAGGTCGTCTTTAATGCAAGCGTG
GTCGAGATAACCGAGAAAGCCATCACCGCCCAGTTCGCTTGTTACTCAATTTCCAATGCCGATGGAAATGCAGTC
CTGAATGCGAAAGGCAAGGTCATTGCAGATTTGGGTAGCTCTAGTCCAGGGACACTTGCAAGTTACGAGTCCAAC
CCTTTCAATCTGGTCAATGTTGACCCAACTGAGTTTTACCGGTACCTCACTAAGATTGGCTATGATTACTCCGAG
CCCTTCCAAGGCGTGTCGCAGATTCACCGCAAGCCTGGATATGCTATCGGTCTGATCGAGGACCAGTCTGGCCTC
TCATGGGAGGATAATCTCACATTTCATCCGGGAGTCCTTGATACTGCTCTACAAACCGCTTTCGCGGCATGGTCC
TTTCCTGGTGATGGTCAGATCTGGTCCCTTCATGTTCCCACTCGGTTTGAGTCGCTAGTTTTCAACCCTCACTTC
TCCCCTCTTGCCCTAGGCAAAGAACGCTCCTTCAAATACGAAACATTCATTCGCACTAATACCCAAGGAAGCCTG
ACTGCCGATATTCACTTGTACACCGCAGATGGCAAGAACTCATGCATCCAGATTGAAGGTGCATCCCTTGTTCCA
TTCTCACCGGGCTCTCCTAAAGACGATCTGCCACTCTTTTCAAGTTTCAAGATGAGACCTGCTGTTCCTGATGGG
CAACTTGCGGCAATGGGCGAGACGATTTCACCCTACGAAGCGCAGGTTTACAAGGACATTGATCGTGTCGCTTTC
TGGTATATCCGAAATGTGGCCCAGACTATTACCCCAGAAGAGTGTGATCAGATTCTGCCCCATTTCAGATACTAT
CTGCGGTGGTGTGAGCGCATGATTGGCATGGTCTCTCGGGGTGAACATCCCAAGGTCCCCGTTGAATGTCTTAAT
GATGAGAGAAAAGACATCACTGAAGTGTTGAGCAAGTATGAGGGCCGCAAAGATATCCGATTTGTTGAGGTGGTC
GGCGACCACCTTGTTGAAGTCGTCCGCAGTGGCACTAGCATGCTAGAGTATATGAACCAGGATGGGCTGATGCTC
GCGGTTTACGAAAATGGTCTGGCAGCCGGGCCAAACAACCGCTGGCTGAGTCGCATCGTCGCCCAAATTGCGCAT
CGCTATCCGGGAATGCATATTTTCGAGATCGGAGCCGGAACGGGCGCATCCACCAAGACAATTTTGCCCGAAGTC
GGCTCAGCCTTTGGAACGTATACTTTCACTGACGTGTCTAGTGGTTTCTTCCCTGAAGCTGAGGAGCGCTTCAAG
GACTATGCCAACCGTATGATCTTCAAGACGTTCAACACTGAGTTCCCGCCAAGCGATCAGGGATTCACTGAAGGC
CAGTACGATGTGGTTATTGCTGCAAATGTTCTTCATGTCTCGGCCGACATGGAGCGATCCATGACAAATGTCCGC
CGACTATTGAAACCCGGTGGTTACTTGATTACCTTAGAGGTGACAAATTGTGACCTTCTCTTCAGCGGTATGACC
GTGGGAACTCTCCCAGGTTGGTGGGTGGCTGCGGAGACTGGACGACCGTGGGGTCCTTGCTTGACGCTGCCTCAG
TGGGACTCTGTACTCCGGCAAACAGGCTTCTCGGGCATTGATACTATGACACCCGATCTCAGTGTATCTCTTCCC
GTCGCGGTCTTTGTTTCCCAGGCCATTGATGATCGAGTTGCTCTCCTTCGAGACCCTCTTTCATTGTCGACCGAG
GATAATTTGGGCACTCTGGTCATCATCGGCGGCACGACGCTACCAGTCTTCGGTATTGTGGAAGATGTTGTGACT
AATCTATCCTCTATATTTGCTGAGGTCATGCTGTTTGAGACTGTTGAAGAGTTGGCAATCTTTGGCTCCGCGGTA
CCTAATGGGGCCAGCATTCTCTGTCTAACTGATCTCGATGAACCATTTATGAAGACATTGACGCCGCAGAAGTTT
ACCAGCTTACAGAAAATGTTCGACGTGGCGGGAACCTTGGTGTTGGTTTCTCGTGGCTGCAGAGCAGATGAACCA
TATTCCATGATGCTTGTGGGCATCGGGCGGACAGTCAAGACCGAAAATCCGAAAATCAACCTTCAACTACTTGAC
ATTGAAGCCGTTGAGGACACAACGGCCAACATGCTGTCTGAAGCTCTGCTTAGACACCATCTTCTGAGGCAATGG
CAGTCTAGGAAAGAACCCCTTCTCTGGTCCTCAGAGCCGGAGGTTGTTATGCAAGACAGACGCGCACTCATTCCG
AGGCTCTTGCCCAGCACAGACAAGAATCAGCGTTACAACTCCCAGAGACGCGCTATAACCAAGGAGGTCGACCCT
AGACAGGCAACCATACAGATGATCCAGAATGGAGTCACATTCGACGTCAATGATGTTTCGCCACTGCTAATTTCC
GATGCACCATCGTCGAAATCCATTACAGTTCGCAGCATTCTTTCCTCATTCCAGTCTCTCAAAATTGGAAGCGCC
GGTTTCCTCCGTCTCATCTACGGTGTGACTTCTTCGTCTGAGACAGTTGTCGCCCTTTCATGCTCCACTCAGTCC
CCAGCAGTTGTACCATCCAAGTGGTGTGTACCAATTGCAGGCCATGCTATGGGTCATAGCCCATCATCACTCCTT
ACAACTTTGGCTGCCAATATCATGGCGAAGGAGGTTCTGAGCTCTGTGCCGGATGGTGGAGTTCTTCTGATACGG
GAGGCAGATGAGCCTTTCAAGTCTTATCTTTTGCACATGGCAAAAGAATTGAGTGTCAGAACGGTTTTTGTTACC
AGTCAGGGCAACACGGGTACCCCTGACAGCTTCTATATCCACCCCAGACTTTCGCAGCATAAATTGAAGCAGCTC
CTTCCTGCAGATGTTGCCGTCTACGCTGATCTATCCCAGGGGGCTGGAGCAGATGATTTATCAGAACTACTTGAT
AAGTGTCTCCCATCTCAATGCGTCCATATCAAACGAAGCTCTCTTCTCAATAATGATATCACTGATCCTCATCCC
CGTTTTTGTGACATGATCAGTCAACTTCTTCAGCAAACAATTGAAACTTCCACGCATTCTGCAAGAACTATCACC
ATTCCGCTTAGCAGAGTGTCCGATCATTCTGTGTTTGAGCCTTTTACCGTGGTTGACTGGTCAATTCAATCCGTT
CCGGTCAAAGTTCAGCCAATCGATTCTGGCATCATCTTCAGGCCGGATCGAACATACTTCTTCGTTGGTCTAGCT
GGCGAGCTGGGTCAGTCCTTGTGCCAATGGATGATTTCTCATGGAGCCAAGTATTTTGTCTTGAGTAGTCGGTCT
CCAAAGGTCAGCCCGAATTTTATTGAGGGGATGGCGCAGCAGGGAGCGACAGTCAGAACATTGCCGTTAGATATT
ACAAGCCGAAGGTCCCTTTGGTCCTGCTACCGAGAGATCAGCCGCACCATGCCCGCCGTTGGCGGCGTCATCAAC
GGTGCCATGATCCTCCAAGACAGCGTTTTCGAAAACATGACCCATGAACAATTCCTCAAAGTGATCAGACCAAAG
GTCCAAGGCACCATACTCTTGGACGAACTATTCTATGACTCACCCCTAGAATTCTTCATCGTCACTTCCTCCATC
ACCACAGCCATCGGTTTCAGCGGACAGGGTAACTACTCGGCGGCGAACACGTTCATGACCTCTCTCATGTACCAG
CGCAAGAAGAGGGGGGTTCCTGGCTCCTCTATGGACATCCCGGCTGTTCACGGTATTGGATATGCCGCCCAAGAG
GATAACTTTGACTTTGAGTATTTCACTACACTCGGCTACAACAATGTTTCTGAGCAAGACTTCTGCACACTTTTT
GCAGAGGCTATTCTCTCCGGTCGCGCCGACTCCCTTGATGAGGCTGAGGTTGTATCAGGTGTTAATTATGTGTCG
CCCGACTTGGATATCCCCCAGACTCACACCAGAGATATCAAATTCTCCCATTACATCCTGACCGCGGAAGAAGGA
TCCAGCGTCAGCGGTAGCAAGTCCGCCGCGCAGGTGAGGGTACAGTTGCAGGGAGTGACAAGCGAAGAGGCAATC
TATGATATTGTCAAAGATTCCTTCCTGGTGAATCTCAAAAAAGTTCTCCAGATCTCAGCTGATGATGATATTGAT
CTTTCAACGCCTCTTGTGGAGCAGGGGCTGGACTCACTTGTGGCTGTAATGGTTCGCTCGTGGTTTTTGAAAGAG
ATCGAGGTCGATATTCCGGTTCTGAAGATCCTTGACGGCAGCTCTATTTCTGATCTTCTTCAACTGGCCGTTTCC
AAGATACCTACATCTATCACTTGTGCAGAGGACCCGAAAAGCTACACTGACACTCCAAGCCCATCGTTACCAACA
CCTGCCAAACCCGTCTTCAATAGTACCATTTCTGGAACACCTAGCGACTCTACACCCAGCTACTCACCACTGCTG
ACACCTAGTGAAAGCGAGACATCATCCATTGAGCTGCTGACTCCAGATGAGCCCCTTAAATCCAAGGAACTAGGG
GCCACAGATAAACTGGCCCGATCGCAACGGGACTTGGTCATTCAGCATTCCCGCCTCACGAGAGAGCCCATGTCC
TTTGGGCAAGCCAGATTCTGGTTCCTCCATCATTTCTTGAAGAGCAAAACGTCCTTCAACTTTTCGACTTCTGCA
CGTCTGGTGGGCCCGCTGCGAGTGACGGCCTTTGAGCGAGCTTTGGACACAGTGATTCAGCGACACGAAGGTCTA
CGTACTAGATTCCTCTGGTTGGATGGGGATATTGGCACACCTATGCAGGAGATTATCTCTCACCCTCTGCTTAAA
TTGGAGACCAAGCGCATATACTCCGATGCTGAGGCAGCCGACGAACTAGAGAGGTTGCAAAATCACGAATATGAT
CTGGAAGACTGGGGGTCTATCAGAGCAATGCTTCTTATTTTTTCCGACACCGTCCACTACTTCCTCCTTGGATGT
CATCATATTGCCTTGGATGGACAAAGTATGCACATTCTTTTCTCGGAGCTCGACGGTTTGTATAACGGTAAAGCT
GTTCCTCGAATCCCCGATGCCTCGCAATACCGAAAGTTTGCTACCAGACAGAAACAAGATTACGAATCTGGGCTA
TTGCAGGCTGACATCGATTTCTTCCGTGACATCGTCCGTGAGGATCCGGGTGCGATTGAGCCGTTCTCGTTCTCG
CACCTCTCAAAGCGGAAGATTCTAGATACCTACCGGCACCATCGCGCGTCGACCCGGCTGGGAGCCGGGTTAGCT
CGCAAGGTCAAGCAAATTGCCCGCAAGCTTCAGAGCACGAATTTTCATTTCTACCTGACTATTCTTCAAGCGCTC
GTATTCCGCCTACTTCCCTATACCAACCAATTCTTTGTCGGAATTGCGGACGCGAACCGAGTGGATAAAGATTCA
ATCAACACGATCGGTTGCCTCGTGAATCTACTGCCGCTCAAGTTCAACCGGGCGGACTCATCCAAACTCGATCAT
GCCGTCAAACTCACACGGAGCAAGGTGTACTCTGCTCTCCAGCACTCGCGAGTGCCATTCGATGTTCTTGTCAAT
GAGCTCGAGATCAACCGTTCCGCCATGCACACCCCAATCTTCCAAATCTTCATGGACTACCGGCTAGGCGACCAC
GAGAACTCGCGGCTAGTCGGTTGCGATGCCGAGCTTTCGTGGAATAATGCTGCTACAGGGTATGATTTGCACCTG
GAGGTGCTTGATACTGTCGATGAAGAGTCGCTCGTTGTTTTGAAAGTGCAAGAGGGTCTCTATTCCAAGGAAGCA
GCGGACTTGCTGCTTCGTGCTTTCACCAATCTCCTAGAACAGGCCACACAAAGTCCTGCCGATCGTATCGATCTA
TCGTCGCCTCTGCTGTGGTCTAGAAAGGATATTGATGATGCGTTAGCGTTGGGAAAGGGTCCGGAACTGAACCCT
GAATGGCCATCGACGGTCGCACACCGCGTTGATGAGATGGTGGATGCACACCCTGATGTCATAGCTATCAAGGAT
GGACATGGACATGCCCTCACCTATAGTGCCATGGCCGACCGCGTTAACACGATCGCTGCTACCCTCCTTGAATAT
GTCTCTGGTGGCGATAGTGTTGCCGTGTTCCAAGAGCCAAGCGCTGACTGGATCTGTTCGCTACTCGCCATCTTC
CGTGTTGGGGCGGCGTATGTCCCCTTGGATCTGAAGAATGGTCTGCAACGGCTTGCGGGTGCTGTTGAAGTTGCC
AGCCCGCGGGTTATCCTCCACGATAAATTCACAGAGGCTCGAGTGCCGGATCTTCGGGTGGCAAGGGCAGCTATC
GTCAATGTCTCCGATATTGACATGAACCCCGATGCCAAAGTACCGAACAGGGCCATGGCAGAGTCCACTGCGGCT
ATTCTGTTCACTAGCGGGTCGACGGGTGTTCCCAAGGGCATCGTACTACCGCATTCTTGCTTCGCGACGCATGTC
GAAGCTGTCGAAAAAGCCTGGGGCGTGGGCGCGGCGGTAGTCCTCCAACAAATTGCCCTCAGTTTTGACTTTTCC
TTGCATCAGATCTTCACGGCCCTTGCCAACGGGGGAACCCTCTTTGTGGTCCCGTACGAGAAACGCGGAGACCCG
TATGAAATCACCAAGATCATGAAGCAAGAAGGAGTCACCCACACCCTGGCCACCCCAACCGAATATGGTATGTGG
TTCGATGCAGGGGCGGACATTCTCTCCCAGTGCTCTTCCTGGAAATGGGCTCTTGTCGGTGGCGAAGCCTTGCCA
AAGTCAATTGTTCGACGCTTCCGGGATTTGAACTCGAGTAATCTCAAGCTCTTCGATTTCTATGGACCTGTAGAG
GCCACTATTGCACTTACCAAAGGCGAGGTCAATTTCGGGCTCGCTGATACTGAACAACCAATTCCGGTTGGAAGG
CTTCTTCCCAACTACTCTGTCTACATTCTAGACGAAGCGCTGCAGCCTCTCCCGATCGGTGTCCCGGGGGAGATT
GTTGTTGGCGGACCCGGAGTGGCGGCAGGTTACCTTGGCCAAGAAGAGCTCACAAACGAGAAGTTTATCCCCGTC
CCTAGCTACTTGCAGGACGAACGCTCCAAGAAGCTTGGATGGAACAGATTATATCGGACCGGTGACCGTGGACGC
CTGAACAACGACGGCACTCTCATATATGAGGGTCGGATCAACGGTGACGATCAGATCAAGCTTCGTGGCATTCGC
ATTGAGCTGGGGGAGATCGAAAATGCTATTATCGAGGTCGCGAACGGCAAAGTCTCTCAGGCGGTTGTTGCTGTC
CATGGCGAAGAGGCTGACAAATTTTTGGTGGCTTATGTTGTCCTTTCATCGCATGGTGAAAAGTCCGGTGACAAT
CTTTTCACAGCCATCAAAGCAGCACTCCCCCTTCCCAGCTATATGCGACCTTCGCTATTCATTCCCATTCACAGT
GTCCCGATGAACGTGCATGGAAAGACTGATCGCAAGGCTCTTTACAATATTCCTTTGCCGGATATCGTGACTTCG
GGTCCCTCTGAGCGAGGTCTGATGAATTTCCAAGAAAAGAAACTCTGTGGATTATGGGAAGAGATCTTGCCAGCA
TATGGTGCCGTAATCAGCTCAGGGACAGACTTCTTCCATGTTGGAGGAAACTCGCTGTTGCTTGTCAAACTTCAA
CGCCGCCTCAAGGAAGCCTTTGCGTTTTCTCCACGACTCGCTGATCTCATGAACTCTAGTACATTGAGCGATATG
GCCCGCCTTCTAGAGGACACGGATGCGAGTGTGGTCGATTGGGAGGCTGAAACATCTGTGCCGGCATCATGGGCT
GATCTCGCACAGAGTGCCACGCCGTCTGCCCCAAATGACAGAATGACGGTCCTTTTGACGGGCGCAACTGGTTAT
ATCGGCCGTCATCTCCTCTCCTCTCTTCTTGAAAGCACCCGTGTGTCCAGAATCATCTGCCTTGTCCGTGACAAA
AGCAAGCTAGTCACAGAATCTGAGAAAGTCGTGGCAATCTCCTGCGCTTTCGACAAGCCCAATCTTGGGCTCACC
TCCGATGAGCTTAGCTATCTGACTCACAATGCCGACATCGTGGTGCATTGTGCTGCCAATCGATCCTTCTGGGAT
GACTACCAGGCACTGAGAGCCGTGAACTTCTATTCCGTCCGTGACATCGCCCGTCTGTGTCTTCCGCGCCGCTTG
CCGCTTCACTTCTTTTCTTCCGGCGCTGTCGCCGACCAAGCGGATCTCGCGGATTCACACGATGGCTATTTGACA
AGCAAATGGGCAGCCGAAAAGTTCCTTCACAATGTATCTCAGGAGTTTGGTTTGCCGGTGCATATCCACAGTCCA
AGCGCAGCAACTGCAGACACGCCGTACACAGTCGACTCCATCGTCCAACAAGACTTTATCGAATGTGCACAGCGT
GTCGGTGCACGGCCCGATCTCGAGGGTACGTCCGGCCATATGGATCTCAGTCAGACGACCGGCTTCATCGCGACA
GCATCGGAGGCCATTCTTAACGGGCGTGAAGACATCGATAACAATGCTCCCATACTCAGGAGGGTGGTATATAAC
CCCACCCAACGGTTCGATATCCAGCGCTCCACTTCTTCTATCGGTGCTGATCCCAGATGGGCGTCACTGCCGACG
ATGGATATGCTGCAGTGGATGGGGAAGGCAAAGCAGAATGGGTTCCCGTATGTGCTGACGGCCCAGCATATTGTG
ATCGGTTCGAAGACGGGACAGGTGGTATCTAGGCGATAG
Gene >Pro_DTO377G3_2|g4740.t1
ATGCCTGAACCAATTGCCATCATCGGAACCGCCTGTCGCTTTCCCGGCGGGTGCGATAGCCCCAGCAAACTCTGG
GGGCTATTGAGAAACCCTCACGACATTGCCAAAAAGGTTCCTCTGGAGCGCTTCAATGTTGATAATTTCTACCAC
CCCGAGGCAACTCACCATGGCACCACGAACGCTACCAAGTCCTACTTTCTTGAGGAGAACATCGCTCAGTTCGAT
GCGCCGTTCTTCAATATACAACCGATGGAGAGCGATGCTGTTGATCCGCAGCAACGTCTACTCCTAGAGACTGTG
TATGACTCCCTGTGCACCGCGGGTCTGCCCATGGAGAACCTCCGCGGCTCGTCTACGGCTGTCTACGTTGGTATG
ATGTGCGATGATTGGTCCACCATGGTGGCGAGCGATGTCGAGACCTTGCCAACCTATACGGCTACCGGCTTAGCT
CGAAGTATTGTGTCCAACCGGATCTCGTATGTCTTTGACTGGCATGGCCCTTCGATGACCATCGATACGGCATGC
TCGTCGAGTCTTGTTGCCGTGCACCACGCCGTGCAGACCTTGCGTAGTGGTGAATCTTCCTTGGCCATAGCCGCT
GGAACCAACTTGATTCTAAGTCCTAGTGAGTACAGACTCCCGAATTGACCGAGTTGCCACTGATCTCTCAAGCCA
TGTACGTAACCGAGACGAACCTGCGAATGTTGTCGCCGAATGGACGGTGCGCGATGTGGGATCGGGCTGCCGATG
GCTATGCTCGTGGCGAGGGAGTCGCCGCTGTAGTCTTAAAGACCTTGAGCCGAGCTCTGGCCGATGGAGACCACA
TAGAGTGCATCATTCGTGAGACTGGAGTGAATCAGGATGGTCGCACTACCGGACTCACCATGCCGAGTAACACCG
CGCAAACGGCGTTAATCCGCGACACGTACCGCCGAGCGGGGCTGGACATCAATGAACCTCACGATCGCCCTCAAT
TCTTCCATGCCCACGGAACTGGCACCCAGGCCGGTGACCCTCAAGAAGCGGAGGCTGTCTCGGCAGCTCTATTTC
CCAATGACTCGAAGGACCACACAGAGCTCTTTGTGGGGTCAATCAAGACTGTGATTGGGCACACTGAAGGCTCTG
CTGGTCTGGCCTCTTTGATTGGGTCCTCGCTGGCTATGAAGCATGGAATCGTACCGCCTAATCTTCACTTTAGCG
AATTGAGCGACAAAGTCGCGCCGTTTTATACGAATCTGAAGATCCCAACAGAGCCCATGCCTTGGCCGAAGCTGG
CTCCCGGTCAAGTCAAACGGGCCAGTATCAATAGTTTTGGTGAGGCGATTTCTCTCGATATCATGTTACTTGCTA
ACTCTTGTAGGTTTTGGTGGAACCAATGCCCACGCCATCATCGAGAGTCTCGAGCAAGATTCCGAAAGAACATTG
AAGCTTCGTTCGGTCGCAAATATCACTCCACTGGTTTTTTCTGCAGCTTCCGAAAAGAGCCTTCGGAATATGCTC
GCCACGTATTCAGTCTACCTGTCCGCCAACCCTACGTTAGATCTCCATGATCTGGCCAGTACGCTCAGCATGCGC
CGATCGACACTACCCTTTCGAACTTACGTTCCAGTCCGTAGCAAGGAAGGGCTACCCAAGCAGTTGAAGACCATG
GCGGATGCCGCCCCAAATGAGTCGGAGCTCAGCGTTCGCCGCTCTCAGATCATTAACCCAGCTATTCTTGGCGTG
TTCACCGGGCAGGGAGCGCAGTGGCCACGGATGGGAGCGTGTCTCATCGAGACCTCAATTTTCGCCCAACAGAAA
ATTGCCTGGCTCGACTCAATTCTTCAAACCTTACCTGCAGAGGACCGCCCGACCTGGACGATCAAGGAGCAGCTG
CTTGCTGGTAGCGAGACTTCCCGGGTGACAGAAGCGGCAGTATCGCAGCCCCTGTGCCTTGCTATTCAGGTGGTA
TTGGTTGATATCCTCCACGCTGCGGGCGTTACATTCAAAGCTGTCGTGGGCCACTCATCCGGTGAGATCGGAGCT
GCGTACGCTGCGGGTCTCCTGTCGGCCGAGGATGCCGTTAGGATCGCATACTACCGTGGCCTGCACGCAAAACAT
GCATCATCACCGAACGGCGAGAAGGGTGCCATGATGGCTGTTGGCGCTTCGCATGTAGAAGCCCTGGACATGTGC
GCCGACTCACGCTTCAAAGGCCGCATTCAGGTCGCGGCAGTGAATTCTAGCTCCAGTATTACAATTTCAGGTGAC
GAAGGCACTATTGATGAGCTCCTTGAGGTACTCAAAGCCGAGCAGAGGTTTGCGAGGAAGCTGAAGGTTGACACC
GCCTATCACTCGGCGCACATGCTACCCTGTGCAGAGCCTTACTTGGAGTCCATGAAGTCGTGCGGAATACAGCCA
GAAGACCGGACAGGGCCTGTATGGCTTTCTAGTGTTACCGAGGGACAGAGAATGGCCAAGGAAATTCTCACTGAA
AGCTACTGGGTTGATAACATGTGCAACACGGTATTATTCTCTGGCGCAGTGGCTCAGGCTGTTTTGGAGGCTGGG
CCATTCGACATGACCATTGAAATCGGTCCGCACCCGGCACTCAAGGGTCCGGTAACATCGACGCTTGAGGAGTTT
GGATGTGAAGCCCCCTACACAGGTCTGCTATCCCGAGCCAAAAACGATGTTCACGAACTATCCGCAAACCTCGGT
TTCATCTGGATGCATCTTGGGTCCGGCAGCATTCAGTTTGACACTGTCGACAAGCTTCTATCTGGGTTCAAAGGA
AACAGGGAAGTCCTCACCAACTTGCCGTCATATCCCTTCGACCATCAGCGTGAATACTGGACTGGGTCCCGCGTG
TCTAATCACCACAAATTTCGTCGAACCCCTCCAAACCCACTGCTCGGGACGCAATGTTCCGAAGCGAACACTGCC
CATGAGATTCAATGGAGAAATATCCTTCGCCCGAGCGAGATCTCTTGGCTCAGTGGGCATCGTCTGCAGGGTCAA
GTGGTTTTCCCAGCCACGGGTTACGTCTCTATGGCCATTGAAGCGACGAAGCAGCTCACTATTCAGAATCATATT
ACTTGCATCAAGATTTACGATCTGGAAATAGGTCGCGCAATTGCTTTCGGCGATGATGCAGCCAGTATCGAGGTC
GTCTTTAATGCAAGCGTGGTCGAGATAACCGAGAAAGCCATCACCGCCCAGTTCGCTTGTTACTCAATTTCCAAT
GCCGATGGAAATGCAGTCCTGAATGCGAAAGGCAAGGTCATTGCAGATTTGGGTAGCTCTAGTCCAGGGACACTT
GCAAGTTACGAGTCCAACCCTTTCAATCTGGTCAATGTTGACCCAACTGAGTTTTACCGGTACCTCACTAAGATT
GGCTATGATTACTCCGAGCCCTTCCAAGGCGTGTCGCAGATTCACCGCAAGCCTGGATATGCTATCGGTCTGATC
GAGGACCAGTCTGGCCTCTCATGGGAGGATAATCTCACATTTCATCCGGGAGTCCTTGATACTGCTCTACAAACC
GCTTTCGCGGCATGGTCCTTTCCTGGTGATGGTCAGATCTGGTCCCTTCATGTTCCCACTCGGTTTGAGTCGCTA
GTTTTCAACCCTCACTTCTCCCCTCTTGCCCTAGGCAAAGAACGCTCCTTCAAATACGAAACATTCATTCGCACT
AATACCCAAGGAAGCCTGACTGCCGATATTCACTTGTACACCGCAGATGGCAAGAACTCATGCATCCAGATTGAA
GGTGCATCCCTTGTTCCATTCTCACCGGGCTCTCCTAAAGACGATCTGCCACTCTTTTCAAGTTTCAAGATGAGA
CCTGCTGTTCCTGATGGGCAACTTGCGGCAATGGGCGAGACGATTTCACCCTACGAAGCGCAGGTTTACAAGGAC
ATTGATCGTGTCGCTTTCTGGTATATCCGAAATGTGGCCCAGACTATTACCCCAGAAGAGTGTGATCAGATTCTG
CCCCATTTCAGATACTATCTGCGGTGGTGTGAGCGCATGATTGGCATGGTCTCTCGGGGTGAACATCCCAAGGTC
CCCGTTGAATGTCTTAATGATGAGAGAAAAGACATCACTGAAGTGTTGAGCAAGTAAGTTCATGACTTTTATTTC
ACCCCAATTCTTCTTCTGCGCAATCTCGAATAGATTATTGATTGTCTTGCATTAGGTATGAGGGCCGCAAAGATA
TCCGATTTGTTGAGGTGGTCGGCGACCACCTTGTTGAAGTCGTCCGCAGTGGCACTAGCATGCTAGAGTATATGA
ACCAGGATGGGCTGATGCTCGCGGTTTACGAAAATGGTCTGGCAGCCGGGCCAAACAACCGCTGGCTGAGTCGCA
TCGTCGCCCAAATTGCGCATCGCTATCCGGGAATGCATATTTTCGAGATCGGTCAGTCTTGATGCTTCATATTAC
ATTAGCTTTCAGCGCACAAGCTGACTTTCTGTAGGAGCCGGAACGGGCGCATCCACCAAGACAATTTTGCCCGAA
GTCGGCTCAGCCTTTGGAACGTATACTTTCACTGACGTGTCTAGTGGTTTCTTCCCTGAAGCTGAGGAGCGCTTC
AAGGACTATGCCAACCGTATGATCTTCAAGACGTTCAACACTGAGTTCCCGCCAAGCGATCAGGGATTCACTGAA
GGCCAGTACGATGTGGTTATTGCTGCAAATGTTCTTCATGTCTCGGCCGACATGGAGCGATCCATGACAAATGTC
CGCCGACTATTGAAACCCGGTGGTTACTTGATTACCTTAGAGGTGACAAATTGTGACCTTCTCTTCAGCGGTATG
ACCGTGGGAACTCTCCCAGGTTGGTGGGTGGCTGCGGAGACTGGACGACCGTGGGGTCCTTGCTTGACGCTGCCT
CAGTGGGACTCTGTACTCCGGCAAACAGGCTTCTCGGGCATTGATACTATGACACCCGATCTCAGTGTATCTCTT
CCCGTCGCGGTCTTTGTTTCCCAGGCCATTGATGATCGAGTTGCTCTCCTTCGAGACCCTCTTTCATTGTCGACC
GAGGATAATTTGGGCACTCTGGTCATCATCGGCGGCACGACGCTACCAGTCTTCGGTATTGTGGAAGATGTTGTG
ACTAATCTATCCTCTATATTTGCTGAGGTCATGCTGTTTGAGACTGTTGAAGAGTTGGCAATCTTTGGCTCCGCG
GTACCTAATGGGGCCAGCATTCTCTGTCTAACTGATCTCGATGAACCATTTATGAAGACATTGACGCCGCAGAAG
TTTACCAGCTTACAGAAAATGTTCGACGTGGCGGGAACCTTGGTGTTGGTTTCTCGTGGCTGCAGAGCAGATGAA
CCATATTCCATGATGCTTGTGGGCATCGGGCGGACAGTCAAGACCGAAAATCCGAAAATCAACCTTCAACTACTT
GACATTGAAGCCGTTGAGGACACAACGGCCAACATGCTGTCTGAAGCTCTGCTTAGACACCATCTTCTGAGGCAA
TGGCAGTCTAGGAAAGAACCCCTTCTCTGGTCCTCAGAGCCGGAGGTTGTTATGCAAGACAGACGCGCACTCATT
CCGAGGCTCTTGCCCAGCACAGACAAGAATCAGCGTTACAACTCCCAGAGACGCGCTATAACCAAGGAGGTCGAC
CCTAGACAGGCAACCATACAGATGATCCAGAATGGAGTCACATTCGACGTCAATGATGTTTCGCCACTGCTAATT
TCCGATGCACCATCGTCGAAATCCATTACAGTTCGCAGCATTCTTTCCTCATTCCAGTCTCTCAAAATTGGAAGC
GCCGGTTTCCTCCGTCTCATCTACGGTGTGACTTCTTCGTCTGAGACAGTTGTCGCCCTTTCATGCTCCACTCAG
TCCCCAGCAGTTGTACCATCCAAGTGGTGTGTACCAATTGCAGGCCATGCTATGGGTCATAGCCCATCATCACTC
CTTACAACTTTGGCTGCCAATATCATGGCGAAGGAGGTTCTGAGCTCTGTGCCGGATGGTGGAGTTCTTCTGATA
CGGGAGGCAGATGAGCCTTTCAAGTCTTATCTTTTGCACATGGCAAAAGAATTGAGTGTCAGAACGGTTTTTGTT
ACCAGTCAGGGCAACACGGGTACCCCTGACAGCTTCTATATCCACCCCAGACTTTCGCAGCATAAATTGAAGCAG
CTCCTTCCTGCAGATGTTGCCGTCTACGCTGATCTATCCCAGGGGGCTGGAGCAGATGATTTATCAGAACTACTT
GATAAGTGTCTCCCATCTCAATGCGTCCATATCAAACGAAGCTCTCTTCTCAATAATGATATCACTGATCCTCAT
CCCCGTTTTTGTGACATGATCAGTCAACTTCTTCAGCAAACAATTGAAACTTCCACGCATTCTGCAAGAACTATC
ACCATTCCGCTTAGCAGAGTGTCCGATCATTCTGTGTTTGAGCCTTTTACCGTGGTTGACTGGTCAATTCAATCC
GTTCCGGTCAAAGTTCAGCCAATCGATTCTGGCATCATCTTCAGGCCGGATCGAACATACTTCTTCGTTGGTCTA
GCTGGCGAGCTGGGTCAGTCCTTGTGCCAATGGATGATTTCTCATGGAGCCAAGTATTTTGTCTTGAGTAGTCGG
TCTCCAAAGGTCAGCCCGAATTTTATTGAGGGGATGGCGCAGCAGGGAGCGACAGTCAGAACATTGCCGTTGTCA
GTAAATTTGCTCCAACTTTTACCTCACCGACTAACAAAACCCAGAGATATTACAAGCCGAAGGTCCCTTTGGTCC
TGCTACCGAGAGATCAGCCGCACCATGCCCGCCGTTGGCGGCGTCATCAACGGTGCCATGATCCTCCAAGACAGC
GTTTTCGAAAACATGACCCATGAACAATTCCTCAAAGTGATCAGACCAAAGGTCCAAGGCACCATACTCTTGGAC
GAACTATTCTATGACTCACCCCTAGAATTCTTCATCGTCACTTCCTCCATCACCACAGCCATCGGTTTCAGCGGA
CAGGGTAACTACTCGGCGGCGAACACGTTCATGACCTCTCTCATGTACCAGCGCAAGAAGAGGGGGGTTCCTGGC
TCCTCTATGGACATCCCGGCTGTTCACGGTATTGGATATGCCGCCCAAGAGGATAACTTTGACTTTGAGTATTTC
ACTACACTCGGCTACAACAATGTTTCTGAGCAAGACTTCTGCACACTTTTTGCAGAGGCTATTCTCTCCGGTCGC
GCCGACTCCCTTGATGAGGCTGAGGTTGTATCAGGTGTTAATTATGTGTCGCCCGACTTGGATATCCCCCAGACT
CACACCAGAGATATCAAATTCTCCCATTACATCCTGACCGCGGAAGAAGGATCCAGCGTCAGCGGTAGCAAGTCC
GCCGCGCAGGTGAGGGTACAGTTGCAGGGAGTGACAAGCGAAGAGGCAATCTATGATATTGTCAAAGGTAAGTCA
CTGATTATTGAACACTACCGACAGCTTGACTGATTTCATAACAGATTCCTTCCTGGTGAATCTCAAAAAAGTTCT
CCAGATCTCAGCTGATGATGATATTGATCTTTCAACGCCTCTTGTGGAGCAGGGGCTGGACTCACTTGTGGCTGT
AATGGTTCGCTCGTGGTTTTTGAAAGAGATCGAGGTCGATATTCCGGTTCTGAAGATCCTTGACGGCAGCTCTAT
TTCTGATCTTCTTCAACTGGCCGTTTCCAAGATACCTACATCTATCACTTGTGCAGAGGACCCGAAAAGCTACAC
TGACACTCCAAGCCCATCGTTACCAACACCTGCCAAACCCGTCTTCAATAGTACCATTTCTGGAACACCTAGCGA
CTCTACACCCAGCTACTCACCACTGCTGACACCTAGTGAAAGCGAGACATCATCCATTGAGCTGCTGACTCCAGA
TGAGCCCCTTAAATCCAAGGAACTAGGGGCCACAGATAAACTGGCCCGATCGCAACGGGACTTGGTCATTCAGCA
TTCCCGCCTCACGAGAGAGCCCATGTCCTTTGGGCAAGCCAGATTCTGGTTCCTCCATCATTTCTTGAAGAGCAA
AACGTCCTTCAACTTTTCGACTTCTGCACGTCTGGTGGGCCCGCTGCGAGTGACGGCCTTTGAGCGAGCTTTGGA
CACAGTGATTCAGCGACACGAAGGTCTACGTACTAGATTCCTCTGGTTGGATGGGGATATTGGCACACCTATGCA
GGAGATTATCTCTCACCCTCTGCTTAAATTGGAGACCAAGCGCATATACTCCGATGCTGAGGCAGCCGACGAACT
AGAGAGGTTGCAAAATCACGAATATGATCTGGAAGACTGGGGGTCTATCAGAGCAATGCTTCTTATTTTTTCCGA
CACCGTCCACTACTTCCTCCTTGGATGTCATCATATTGCCTTGGATGGACAAAGTATGCACATTCTTTTCTCGGA
GCTCGACGGTTTGTATAACGGTAAAGCTGTTCCTCGAATCCCCGATGCCTCGCAATACCGAAAGTTTGCTACCAG
ACAGAAACAAGATTACGAATCTGGGCTATTGCAGGCTGACATCGATTTCTTCCGTGACATCGTCCGTGAGGATCC
GGGTGCGATTGAGCCGTTCTCGTTCTCGCACCTCTCAAAGCGGAAGATTCTAGATACCTACCGGTGAGTTGACAA
TGAAATCGGGTTGATTATTTTCTGACATTGTTCTAGGCACCATCGCGCGTCGACCCGGCTGGGAGCCGGGTTAGC
TCGCAAGGTCAAGCAAATTGCCCGCAAGCTTCAGAGCACGAATTTTCATTTCTACCTGACTATTCTTCAAGCGCT
CGTATTCCGCCTACTTCCCTATACCAACCAATTCTTTGTCGGAATTGCGGACGCGAACCGAGTGGATAAAGATTC
AATCAACACGATCGGTTGCCTCGTGAATCTACTGCCGCTCAAGTTCAACCGGGCGGACTCATCCAAACTCGATCA
TGCCGTCAAACTCACACGGAGCAAGGTGTACTCTGCTCTCCAGCACTCGCGAGTGCCATTCGATGTTCTTGTCAA
TGAGCTCGAGATCAACCGTTCCGCCATGCACACCCCAATCTTCCAAATCTTCATGGACTACCGGCTAGGCGACCA
CGAGAACTCGCGGCTAGTCGGTTGCGATGCCGAGCTTTCGTGGAATAATGCTGCTACAGGGTATGATTTGCACCT
GGAGGTGCTTGATACTGTCGATGAAGAGTCGCTCGTTGTTTTGAAAGTGCAAGAGGGTCTCTATTCCAAGGAAGC
AGCGGACTTGCTGCTTCGTGCTTTCACCAATCTCCTAGAACAGGCCACACAAAGTCCTGCCGATCGTATCGATCT
ATCGTCGCCTCTGCTGTGGTCTAGAAAGGATATTGATGATGCGTTAGCGTTGGGAAAGGGTATGTCACACTTCGA
AATCAGGGAGATTACGACTAATCCTCCTCTATAGGTCCGGAACTGAACCCTGAATGGCCATCGACGGTCGCACAC
CGCGTTGATGAGATGGTGGATGCACACCCTGATGTCATAGCTATCAAGGATGGACATGGACATGCCCTCACCTAT
AGTGCCATGGCCGACCGCGTTAACACGATCGCTGCTACCCTCCTTGAATATGTCTCTGGTGGCGATAGTGTTGCC
GTGTTCCAAGAGCCAAGCGCTGACTGGATCTGTTCGCTACTCGCCATCTTCCGTGTTGGGGCGGCGTATGTCCCC
TTGGATCTGAAGAATGGTCTGCAACGGCTTGCGGGTGCTGTTGAAGTTGCCAGCCCGCGGGTTATCCTCCACGAT
AAATTCACAGAGGCTCGAGTGCCGGATCTTCGGGTGGCAAGGGCAGCTATCGTCAATGTCTCCGATATTGACATG
AACCCCGATGCCAAAGTACCGAACAGGGCCATGGCAGAGTCCACTGCGGCTATTCTGTTCACTAGCGGGTCGACG
GGTGTTCCCAAGGGCATCGTACTACCGCATTCTTGCTTCGCGACGCATGTCGAAGCTGTCGAAAAAGCCTGGGGC
GTGGGCGCGGCGGTAGTCCTCCAACAAATTGCCCTCAGTTTTGACTTTTCCTTGCATCAGATCTTCACGGCCCTT
GCCAACGGGGGAACCCTCTTTGTGGTCCCGTACGAGAAACGCGGAGACCCGTATGAAATCACCAAGATCATGAAG
CAAGAAGGAGTCACCCACACCCTGGCCACCCCAACCGAATATGGTATGTGGTTCGATGCAGGGGCGGACATTCTC
TCCCAGTGCTCTTCCTGGAAATGGGCTCTTGTCGGTGGCGAAGCCTTGCCAAAGTCAATTGTTCGACGCTTCCGG
GATTTGAACTCGAGTAATCTCAAGCTCTTCGATTTCTATGGACCTGTAGAGGCCACTATTGCACTTACCAAAGGC
GAGGTCAATTTCGGGCTCGCTGATACTGAACAACCAATTCCGGTTGGAAGGCTTCTTCCCAACTACTCTGTCTAC
ATTCTAGACGAAGCGCTGCAGCCTCTCCCGATCGGTGTCCCGGGGGAGATTGTTGTTGGCGGACCCGGAGTGGCG
GCAGGTTACCTTGGCCAAGAAGAGCTCACAAACGAGAAGTTTATCCCCGTCCCTAGCTACTTGCAGGACGAACGC
TCCAAGAAGCTTGGATGGAACAGATTATATCGGACCGGTGACCGTGGACGCCTGAACAACGACGGCACTCTCATA
TATGAGGGTCGGATCAACGGTGACGATCAGATCAAGCTTCGTGGCATTCGCATTGAGCTGGGGGAGATCGAAAAT
GCTATTATCGAGGTCGCGAACGGCAAAGTCTCTCAGGCGGTTGTTGCTGTCCATGGCGAAGAGGCTGACAAATTT
TTGGTGGCTTATGTTGTCCTTTCATCGCATGGTGAAAAGTCCGGTGACAATCTTTTCACAGCCATCAAAGCAGCA
CTCCCCCTTCCCAGCTATATGCGACCTTCGCTATTCATTCCCATTCACAGTGTCCCGATGAACGTGCATGGAAAG
ACTGATCGCAAGGCTCTTTACAATATTCCTTTGCCGGATATCGTGACTTCGGGTCCCTCTGAGCGAGGTCTGATG
AATTTCCAAGAAAAGAAACTCTGTGGATTATGGGAAGAGATCTTGCCAGCATATGGTGCCGTAATCAGCTCAGGG
ACAGACTTCTTCCATGTTGGAGGAAACTCGCTGTTGCTTGTCAAACTTCAACGCCGCCTCAAGGAAGCCTTTGCG
TTTTCTCCACGACTCGCTGATCTCATGAACTCTAGTACATTGAGCGATATGGCCCGCCTTCTAGAGGACACGGAT
GCGAGTGTGGTCGATTGGGAGGCTGAAACATCTGTGCCGGCATCATGGGCTGATCTCGCACAGAGTGCCACGCCG
TCTGCCCCAAATGACAGAATGACGGTCCTTTTGACGGGCGCAACTGGTTATATCGGCCGTCATCTCCTCTCCTCT
CTTCTTGAAAGCACCCGTGTGTCCAGAATCATCTGCCTTGTCCGTGACAAAAGCAAGCTAGTCACAGAATCTGAG
AAAGTCGTGGCAATCTCCTGCGCTTTCGACAAGCCCAATCTTGGGCTCACCTCCGATGAGCTTAGCTATCTGACT
CACAATGCCGACATCGTGGTGCATTGTGCTGCCAATCGATCCTTCTGGGATGACTACCAGGCACTGAGAGCCGTG
AACTTCTATTCCGTCCGTGACATCGCCCGTCTGTGTCTTCCGCGCCGCTTGCCGCTTCACTTCTTTTCTTCCGGC
GCTGTCGCCGACCAAGCGGATCTCGCGGATTCACACGATGGCTATTTGACAAGCAAATGGGCAGCCGAAAAGTTC
CTTCACAATGTATCTCAGGAGTTTGGTTTGCCGGTGCATATCCACAGTCCAAGCGCAGCAACTGCAGACACGCCG
TACACAGTCGACTCCATCGTCCAACAAGACTTTATCGAATGTGCACAGCGTGTCGGTGCACGGCCCGATCTCGAG
GGTACGTCCGGCCATATGGATCTCAGTCAGACGACCGGCTTCATCGCGACAGCATCGGAGGCCATTCTTAACGGG
CGTGAAGACATCGATAACAATGCTCCCATACTCAGGAGGGTGGTATATAACCCCACCCAACGGTTCGATATCCAG
CGCTCCACTTCTTCTATCGGTGCTGATCCCAGATGGGCGTCACTGCCGACGATGGATATGCTGCAGTGGATGGGG
AAGGCAAAGCAGAATGGGTTCCCGTATGTGCTGACGGCCCAGCATATTGTGATCGGTTCGAAGACGGGACAGGTG
GTATCTAGGCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail