Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4736.t1
Gene name
Locationscaffold_10:255779..257831
Strand-
Gene length (bp)2052
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07885 Ion_trans_2 Ion channel 1.2E-12 213 286
PF07885 Ion_trans_2 Ion channel 2.2E-16 370 445

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 94 116 22
3 129 151 22
4 166 188 22
5 208 227 19
6 263 285 22
7 360 382 22
8 392 414 22
9 421 440 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4736.t1
MNEPGFDDAIADEAVALDRTASSPNQKIDEINKLSQHDTEYQQAARWWLASTAYPLVAGTFGPMASAFNICSLSQ
PWRMDLTSSGGTDIPDPKWVTAINAISLVFALVANLALSLTMARRIRFEIAQPIIVVGWYISSAFLIAILIPFGV
NMYKPENNGRIYSQSYYYGTFAAGLYFIIASLMAVTGYGAYRGYSSRKFNLTTSQRTLMLQTIIFCFYLLGGAAV
YSKVEGWRFLDAVYFADYTLLTIGVGNFSPSTHLGRGLLFPYAIGGIIILGLIISSIRTLMLENGKQKIGNMLTA
QTRKYLLREAFSDRSGAKGIIPSLGKKSAKAEGRSEREQRKREFIAMRQVCKLANVQHKWLSLLLSFLLWMTIWL
IGGVVFWRSESNAKWSYFEALYFAYTSLLTVGYGDLYPISSLGKSFFVFWSLLAVPTITILISNIGDTVIRFIRD
VTLFIGELTILPGDHSFVDRLKTLTHISWVRWWMEETTGEKEGAQQHAQFSQNQDPNKENGNDFDFKNNKEEKQA
ENIHQYIYLLFRELRKIIEYASNTPSRKFDYLEWEYYMSLIEGDNKPKVLGDEANDGQAQAAREWSWTDQENPLL
AETSEVQWLLGRLTEVLDRELRRASQVHHVSERAKGDGAED*
Coding >Pro_DTO377G3_2|g4736.t1
ATGAACGAACCTGGTTTCGATGACGCCATTGCCGACGAAGCAGTGGCTCTCGACCGCACCGCCAGCTCTCCAAAT
CAGAAGATAGACGAAATCAATAAGTTGTCGCAACATGATACCGAGTACCAGCAAGCTGCGCGTTGGTGGCTCGCA
AGTACGGCATACCCTCTAGTAGCTGGCACTTTCGGGCCGATGGCTAGCGCTTTCAATATCTGTTCTTTATCACAA
CCATGGCGAATGGACCTCACCAGCAGCGGTGGGACAGATATCCCGGATCCAAAATGGGTCACCGCTATCAACGCA
ATATCACTTGTCTTTGCACTTGTCGCCAACCTAGCCCTCTCGCTTACCATGGCCCGACGCATCCGTTTCGAAATC
GCCCAGCCAATCATCGTCGTAGGGTGGTACATCTCATCGGCGTTCTTGATCGCAATCTTAATTCCCTTCGGCGTG
AACATGTACAAGCCCGAGAACAACGGTCGAATCTACTCGCAGAGTTATTACTATGGCACATTCGCAGCAGGGTTA
TATTTCATCATCGCGTCATTAATGGCAGTGACTGGATATGGTGCCTACCGTGGCTACTCTAGCCGAAAATTCAAT
CTGACTACGAGCCAACGAACACTCATGCTGCAAACTATCATTTTCTGCTTCTATCTTCTGGGCGGTGCAGCCGTC
TACTCTAAGGTCGAGGGATGGCGCTTCCTAGACGCAGTATATTTTGCAGACTATACATTGCTCACCATCGGCGTG
GGTAATTTCTCGCCAAGTACGCATCTCGGCCGGGGTTTGCTTTTCCCATATGCAATCGGAGGAATCATTATCCTT
GGTCTTATCATATCCTCCATCCGTACGCTTATGTTGGAAAATGGCAAGCAAAAGATTGGCAACATGTTGACAGCA
CAAACGCGCAAATACCTACTCAGAGAAGCCTTCTCGGACCGTTCTGGTGCTAAGGGTATTATCCCCTCGCTCGGG
AAGAAGAGTGCCAAAGCGGAAGGCCGCAGCGAGCGGGAGCAGCGCAAACGAGAGTTTATAGCCATGCGTCAGGTA
TGTAAGCTGGCAAACGTCCAACACAAATGGCTCTCGCTCTTGCTTTCTTTTTTGCTTTGGATGACGATATGGCTG
ATCGGAGGTGTCGTTTTCTGGCGCTCGGAGTCGAACGCAAAATGGTCGTACTTTGAGGCTCTATACTTTGCATAT
ACAAGTCTTCTGACAGTTGGTTATGGAGATTTGTATCCGATCAGTAGTTTGGGTAAATCCTTCTTCGTTTTTTGG
TCCCTGCTTGCCGTTCCTACGATTACTATTCTCATCTCCAATATTGGCGATACCGTCATCCGATTTATTCGTGAC
GTTACGCTATTCATTGGCGAGCTCACTATTCTACCGGGTGACCACTCCTTCGTGGACAGGCTTAAGACACTGACT
CACATCTCCTGGGTCAGATGGTGGATGGAGGAAACGACGGGCGAAAAAGAAGGTGCACAACAGCACGCACAATTC
AGCCAAAATCAAGATCCCAATAAAGAGAACGGCAACGACTTCGACTTCAAGAACAACAAGGAAGAAAAGCAAGCC
GAAAACATCCACCAGTACATCTACCTACTCTTCCGAGAGCTACGCAAAATTATTGAGTACGCCAGCAACACTCCA
TCCCGGAAATTCGATTATCTAGAATGGGAATATTATATGAGCCTGATTGAAGGAGATAATAAACCCAAGGTTCTT
GGAGATGAAGCCAATGATGGACAGGCGCAAGCAGCACGGGAATGGAGTTGGACTGATCAGGAGAATCCTTTGCTT
GCCGAAACGAGTGAGGTTCAGTGGCTGCTTGGGCGGTTGACTGAGGTACTTGATCGGGAATTAAGGAGGGCAAGT
CAGGTTCATCATGTATCCGAGAGAGCAAAGGGGGATGGAGCAGAGGATTAG
Transcript >Pro_DTO377G3_2|g4736.t1
ATGAACGAACCTGGTTTCGATGACGCCATTGCCGACGAAGCAGTGGCTCTCGACCGCACCGCCAGCTCTCCAAAT
CAGAAGATAGACGAAATCAATAAGTTGTCGCAACATGATACCGAGTACCAGCAAGCTGCGCGTTGGTGGCTCGCA
AGTACGGCATACCCTCTAGTAGCTGGCACTTTCGGGCCGATGGCTAGCGCTTTCAATATCTGTTCTTTATCACAA
CCATGGCGAATGGACCTCACCAGCAGCGGTGGGACAGATATCCCGGATCCAAAATGGGTCACCGCTATCAACGCA
ATATCACTTGTCTTTGCACTTGTCGCCAACCTAGCCCTCTCGCTTACCATGGCCCGACGCATCCGTTTCGAAATC
GCCCAGCCAATCATCGTCGTAGGGTGGTACATCTCATCGGCGTTCTTGATCGCAATCTTAATTCCCTTCGGCGTG
AACATGTACAAGCCCGAGAACAACGGTCGAATCTACTCGCAGAGTTATTACTATGGCACATTCGCAGCAGGGTTA
TATTTCATCATCGCGTCATTAATGGCAGTGACTGGATATGGTGCCTACCGTGGCTACTCTAGCCGAAAATTCAAT
CTGACTACGAGCCAACGAACACTCATGCTGCAAACTATCATTTTCTGCTTCTATCTTCTGGGCGGTGCAGCCGTC
TACTCTAAGGTCGAGGGATGGCGCTTCCTAGACGCAGTATATTTTGCAGACTATACATTGCTCACCATCGGCGTG
GGTAATTTCTCGCCAAGTACGCATCTCGGCCGGGGTTTGCTTTTCCCATATGCAATCGGAGGAATCATTATCCTT
GGTCTTATCATATCCTCCATCCGTACGCTTATGTTGGAAAATGGCAAGCAAAAGATTGGCAACATGTTGACAGCA
CAAACGCGCAAATACCTACTCAGAGAAGCCTTCTCGGACCGTTCTGGTGCTAAGGGTATTATCCCCTCGCTCGGG
AAGAAGAGTGCCAAAGCGGAAGGCCGCAGCGAGCGGGAGCAGCGCAAACGAGAGTTTATAGCCATGCGTCAGGTA
TGTAAGCTGGCAAACGTCCAACACAAATGGCTCTCGCTCTTGCTTTCTTTTTTGCTTTGGATGACGATATGGCTG
ATCGGAGGTGTCGTTTTCTGGCGCTCGGAGTCGAACGCAAAATGGTCGTACTTTGAGGCTCTATACTTTGCATAT
ACAAGTCTTCTGACAGTTGGTTATGGAGATTTGTATCCGATCAGTAGTTTGGGTAAATCCTTCTTCGTTTTTTGG
TCCCTGCTTGCCGTTCCTACGATTACTATTCTCATCTCCAATATTGGCGATACCGTCATCCGATTTATTCGTGAC
GTTACGCTATTCATTGGCGAGCTCACTATTCTACCGGGTGACCACTCCTTCGTGGACAGGCTTAAGACACTGACT
CACATCTCCTGGGTCAGATGGTGGATGGAGGAAACGACGGGCGAAAAAGAAGGTGCACAACAGCACGCACAATTC
AGCCAAAATCAAGATCCCAATAAAGAGAACGGCAACGACTTCGACTTCAAGAACAACAAGGAAGAAAAGCAAGCC
GAAAACATCCACCAGTACATCTACCTACTCTTCCGAGAGCTACGCAAAATTATTGAGTACGCCAGCAACACTCCA
TCCCGGAAATTCGATTATCTAGAATGGGAATATTATATGAGCCTGATTGAAGGAGATAATAAACCCAAGGTTCTT
GGAGATGAAGCCAATGATGGACAGGCGCAAGCAGCACGGGAATGGAGTTGGACTGATCAGGAGAATCCTTTGCTT
GCCGAAACGAGTGAGGTTCAGTGGCTGCTTGGGCGGTTGACTGAGGTACTTGATCGGGAATTAAGGAGGGCAAGT
CAGGTTCATCATGTATCCGAGAGAGCAAAGGGGGATGGAGCAGAGGATTAG
Gene >Pro_DTO377G3_2|g4736.t1
ATGAACGAACCTGGTTTCGATGACGCCATTGCCGACGAAGCAGTGGCTCTCGACCGCACCGCCAGCTCTCCAAAT
CAGAAGATAGACGAAATCAATAAGTTGTCGCAACATGATACCGAGTACCAGCAAGCTGCGCGTTGGTGGCTCGCA
AGTACGGCATACCCTCTAGTAGCTGTATGCAGAAACCTACTATGTCATCCTTTACTTTGGAAGTCCACATTCTCA
TTATTCTTTTCAGGGCACTTTCGGGCCGATGGCTAGCGCTTTCAATATCTGTTCTTTATCACAACCATGGCGAAT
GGACCTCACCAGCAGCGGTGGGACAGATATCCCGGATCCAAAATGGTAATTAATATGATCAGACATACCCTGAAT
GATTCTCCCGGTAACCTCATATGCGGTTGCAGGGTCACCGCTATCAACGCAATATCACTTGTCTTTGCACTTGTC
GCCAACCTAGCCCTCTCGCTTACCATGGCCCGACGCATCCGTTTCGAAATCGCCCAGCCAATCATCGTCGTAGGG
TGGTACATCTCATCGGCGTTCTTGATCGCAATCTTAATTCCCTTCGGCGTGAACATGTACAAGCCCGAGAACAAC
GGTCGAATCTACTCGCAGAGTTATTACTATGGCACATTCGCAGCAGGGTTATATTTCATCATCGCGTCATTAATG
GCAGTGACTGGATATGGTGCCTACCGTGGCTACTCTAGCCGAAAATTCAATCTGACTACGAGCCAACGAACACTC
ATGCTGCAAACTATCATTTTCTGCTTCTATCTTCTGGGCGGTGCAGCCGTCTACTCTAAGGTCGAGGGATGGCGC
TTCCTAGACGCAGTATATTTTGCAGACTATACATTGCTCACCATCGGCGTGGGTAATTTCTCGCCAAGTACGCAT
CTCGGCCGGGGTTTGCTTTTCCCATATGCAATCGGAGGAATCATTATCCTTGGTCTTATCATATCCTCCATCCGT
ACGCTTATGTTGGAAAATGGCAAGCAAAAGATTGGCAACATGTTGACAGCACAAACGCGCAAATACCTACTCAGA
GAAGCCTTCTCGGACCGTTCTGGTGCTAAGGGTATTATCCCCTCGCTCGGGAAGAAGAGTGCCAAAGCGGAAGGC
CGCAGCGAGCGGGAGCAGCGCAAACGAGAGTTTATAGCCATGCGTCAGGTATGTAAGCTGGCAAACGTCCAACAC
AAATGGCTCTCGCTCTTGCTTTCTTTTTTGCTTTGGATGACGATATGGCTGATCGGAGGTGTCGTTTTCTGGCGC
TCGGAGTCGAACGCAAAATGGTCGTACTTTGAGGCTCTATACTTTGCATATACAAGTCTTCTGACAGTTGGTTAT
GGAGATTTGTATCCGATCAGTAGTTTGGGTAAATCCTTCTTCGTTTTTTGGTCCCTGCTTGCCGTTCCTACGATT
ACTATTCTCATCTCCAATATTGGCGATACCGTCATCCGATTTATTCGTGACGTTACGCTATTCATTGGCGAGCTC
ACTATTCTACCGGGTGACCACTCCTTCGTGGACAGGCTTAAGACACTGACTCACATCTCCTGGGTCAGATGGTGG
ATGGAGGAAACGACGGGCGAAAAAGAAGGTGCACAACAGCACGCACAATTCAGCCAAAATCAAGATCCCAATAAA
GAGAACGGCAACGACTTCGACTTCAAGAACAACAAGGAAGAAAAGCAAGCCGAAAACATCCACCAGTACATCTAC
CTACTCTTCCGAGAGCTACGCAAAATTATTGAGTACGCCAGCAACACTCCATCCCGGAAATTCGATTATCTAGAA
TGGGAATATTATATGAGCCTGATTGAAGGAGATAATAAACCCAAGGTTCTTGGAGATGAAGCCAATGATGGACAG
GCGCAAGCAGCACGGGAATGGAGTTGGACTGATCAGGAGAATCCTTTGCTTGCCGAAACGAGTGAGGTTCAGTGG
CTGCTTGGGCGGTTGACTGAGGTACTTGATCGGGAATTAAGGAGGGCAAGTCAGGTTCATCATGTATCCGAGAGA
GCAAAGGGGGATGGAGCAGAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail