Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4732.t1
Gene name
Locationscaffold_10:244602..245775
Strand-
Gene length (bp)1173
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02458 Transferase Transferase family 4.6E-07 15 234

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 22.44 10.78 34.09
5d_25C Five days - 25 degrees Celsius 30.72 16.00 45.45
7d_25C Seven days - 25 degrees Celsius 40.78 20.48 61.07
10d_25C Ten days - 25 degrees Celsius 13.68 5.19 22.16
7d_15C Seven days - 15 degrees Celsius 61.73 29.32 94.15
7d_30C Seven days - 30 degrees Celsius 8.55 3.05 14.05

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.300393 no
3d_25C 7d_25C 0.024892 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.001278 yes
3d_25C 10d_25C 0.130487 no
5d_25C 7d_25C 0.360277 no
5d_25C 7d_15C 0.009124 yes
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.008807 yes
7d_25C 7d_15C 0.159081 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.000700 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.212585 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4732.t1
MESALGGVQSGMSMLETSDSKQHLCPLPPLIPSTERQPVIRFQANIFTDAIVLAMTFSHIVFDGTGAAKILALLG
RCCRDPSVTPLPLIIDEQDRAQSAIFAGLADTSPAQDHTAELGPAPAIHPVPLDAASLRTCRFEFNSERILQLKY
QCSQVLKNACMFQPNSASIPVADLPPFLSSNDVLTSALADAIQRVKSQSKTYDCLDLCMAVNMRGRIELSAAREF
LGNMACNLRLKTPGPEYTGPEQCLSCRKTHDCPIQTDQLRFLTDLACKVRNKVRNMDRKYFQSCMTYIANQKDWS
QTGMIFTDLAFSSWRHLDIYGLDFGDSFGIVHNFDLSFGLIEGDVIFLPKRLTCDQKEAGWDVHITLPAKDLEAL
VKDDLIRWLMGRDGE*
Coding >Pro_DTO377G3_2|g4732.t1
ATGGAAAGCGCGTTAGGAGGCGTGCAGAGTGGCATGTCAATGCTTGAGACATCTGACTCCAAGCAGCATCTTTGT
CCGCTCCCACCGCTTATTCCCTCGACTGAAAGACAGCCTGTGATTCGGTTCCAGGCAAATATTTTCACGGATGCA
ATCGTGCTGGCGATGACGTTCAGCCATATTGTTTTTGACGGAACAGGCGCGGCAAAAATCCTTGCGTTACTGGGA
AGATGCTGCCGAGACCCATCAGTTACCCCGCTGCCGCTCATCATTGACGAGCAAGATCGAGCTCAGAGCGCTATA
TTTGCGGGACTGGCAGACACGTCTCCTGCCCAAGATCACACGGCAGAACTTGGTCCTGCGCCGGCAATACACCCC
GTTCCCCTTGACGCAGCGTCGCTCAGAACATGTCGCTTTGAATTCAACAGTGAGCGAATTTTGCAGCTCAAATAC
CAATGTTCTCAAGTCTTAAAGAACGCCTGCATGTTCCAGCCAAATAGTGCGTCTATTCCTGTCGCTGATCTTCCA
CCCTTCTTGTCGAGCAATGATGTCTTGACTTCGGCTCTTGCGGACGCAATACAAAGGGTCAAATCTCAAAGCAAG
ACATATGACTGCCTAGACTTATGCATGGCAGTCAACATGCGCGGTCGGATCGAGCTATCCGCAGCAAGAGAGTTT
CTGGGAAACATGGCATGTAATCTTCGATTAAAAACTCCAGGCCCGGAGTATACCGGGCCAGAGCAGTGTTTGTCT
TGCAGGAAAACCCACGATTGCCCAATTCAGACAGACCAACTCCGATTCCTGACTGATTTGGCGTGCAAAGTGAGG
AACAAAGTACGAAACATGGATAGAAAATATTTCCAGAGCTGCATGACATACATCGCAAACCAGAAGGATTGGAGT
CAAACCGGCATGATATTTACCGACCTTGCTTTTTCTAGTTGGCGACATCTTGATATTTATGGTCTGGATTTTGGT
GACAGTTTTGGAATTGTCCACAATTTCGATCTTTCGTTCGGCCTGATTGAGGGTGATGTCATTTTTCTCCCGAAA
CGACTCACTTGTGACCAAAAGGAAGCAGGTTGGGACGTTCATATCACGCTACCTGCGAAGGATCTTGAAGCACTT
GTCAAAGATGATCTCATTCGCTGGTTGATGGGTCGGGATGGAGAATGA
Transcript >Pro_DTO377G3_2|g4732.t1
ATGGAAAGCGCGTTAGGAGGCGTGCAGAGTGGCATGTCAATGCTTGAGACATCTGACTCCAAGCAGCATCTTTGT
CCGCTCCCACCGCTTATTCCCTCGACTGAAAGACAGCCTGTGATTCGGTTCCAGGCAAATATTTTCACGGATGCA
ATCGTGCTGGCGATGACGTTCAGCCATATTGTTTTTGACGGAACAGGCGCGGCAAAAATCCTTGCGTTACTGGGA
AGATGCTGCCGAGACCCATCAGTTACCCCGCTGCCGCTCATCATTGACGAGCAAGATCGAGCTCAGAGCGCTATA
TTTGCGGGACTGGCAGACACGTCTCCTGCCCAAGATCACACGGCAGAACTTGGTCCTGCGCCGGCAATACACCCC
GTTCCCCTTGACGCAGCGTCGCTCAGAACATGTCGCTTTGAATTCAACAGTGAGCGAATTTTGCAGCTCAAATAC
CAATGTTCTCAAGTCTTAAAGAACGCCTGCATGTTCCAGCCAAATAGTGCGTCTATTCCTGTCGCTGATCTTCCA
CCCTTCTTGTCGAGCAATGATGTCTTGACTTCGGCTCTTGCGGACGCAATACAAAGGGTCAAATCTCAAAGCAAG
ACATATGACTGCCTAGACTTATGCATGGCAGTCAACATGCGCGGTCGGATCGAGCTATCCGCAGCAAGAGAGTTT
CTGGGAAACATGGCATGTAATCTTCGATTAAAAACTCCAGGCCCGGAGTATACCGGGCCAGAGCAGTGTTTGTCT
TGCAGGAAAACCCACGATTGCCCAATTCAGACAGACCAACTCCGATTCCTGACTGATTTGGCGTGCAAAGTGAGG
AACAAAGTACGAAACATGGATAGAAAATATTTCCAGAGCTGCATGACATACATCGCAAACCAGAAGGATTGGAGT
CAAACCGGCATGATATTTACCGACCTTGCTTTTTCTAGTTGGCGACATCTTGATATTTATGGTCTGGATTTTGGT
GACAGTTTTGGAATTGTCCACAATTTCGATCTTTCGTTCGGCCTGATTGAGGGTGATGTCATTTTTCTCCCGAAA
CGACTCACTTGTGACCAAAAGGAAGCAGGTTGGGACGTTCATATCACGCTACCTGCGAAGGATCTTGAAGCACTT
GTCAAAGATGATCTCATTCGCTGGTTGATGGGTCGGGATGGAGAATGA
Gene >Pro_DTO377G3_2|g4732.t1
ATGGAAAGCGCGTTAGGAGGCGTGCAGAGTGGCATGTCAATGCTTGAGACATCTGACTCCAAGCAGCATCTTTGT
CCGCTCCCACCGCTTATTCCCTCGACTGAAAGACAGCCTGTGATTCGGTTCCAGGCAAATATTTTCACGGATGCA
ATCGTGCTGGCGATGACGTTCAGCCATATTGTTTTTGACGGAACAGGCGCGGCAAAAATCCTTGCGTTACTGGGA
AGATGCTGCCGAGACCCATCAGTTACCCCGCTGCCGCTCATCATTGACGAGCAAGATCGAGCTCAGAGCGCTATA
TTTGCGGGACTGGCAGACACGTCTCCTGCCCAAGATCACACGGCAGAACTTGGTCCTGCGCCGGCAATACACCCC
GTTCCCCTTGACGCAGCGTCGCTCAGAACATGTCGCTTTGAATTCAACAGTGAGCGAATTTTGCAGCTCAAATAC
CAATGTTCTCAAGTCTTAAAGAACGCCTGCATGTTCCAGCCAAATAGTGCGTCTATTCCTGTCGCTGATCTTCCA
CCCTTCTTGTCGAGCAATGATGTCTTGACTTCGGCTCTTGCGGACGCAATACAAAGGGTCAAATCTCAAAGCAAG
ACATATGACTGCCTAGACTTATGCATGGCAGTCAACATGCGCGGTCGGATCGAGCTATCCGCAGCAAGAGAGTTT
CTGGGAAACATGGCATGTAATCTTCGATTAAAAACTCCAGGCCCGGAGTATACCGGGCCAGAGCAGTGTTTGTCT
TGCAGGAAAACCCACGATTGCCCAATTCAGACAGACCAACTCCGATTCCTGACTGATTTGGCGTGCAAAGTGAGG
AACAAAGTACGAAACATGGATAGAAAATATTTCCAGAGCTGCATGACATACATCGCAAACCAGAAGGATTGGAGT
CAAACCGGCATGATATTTACCGACCTTGCTTTTTCTAGTTGGCGACATCTTGATATTTATGGTCTGGATTTTGGT
GACAGTTTTGGAATTGTCCACAATTTCGATCTTTCGTTCGGCCTGATTGAGGGTGATGTCATTTTTCTCCCGAAA
CGACTCACTTGTGACCAAAAGGAAGCAGGTTGGGACGTTCATATCACGCTACCTGCGAAGGATCTTGAAGCACTT
GTCAAAGATGATCTCATTCGCTGGTTGATGGGTCGGGATGGAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail