Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4703.t1
Gene name
Locationscaffold_10:183142..183966
Strand-
Gene length (bp)824
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.5E-15 73 142

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 196.56 119.21 273.91
5d_25C Five days - 25 degrees Celsius 185.45 111.88 259.02
7d_25C Seven days - 25 degrees Celsius 176.30 105.83 246.76
10d_25C Ten days - 25 degrees Celsius 167.00 99.64 234.35
7d_15C Seven days - 15 degrees Celsius 210.99 128.14 293.84
7d_30C Seven days - 30 degrees Celsius 155.86 92.07 219.64

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.859240 no
3d_25C 7d_25C 0.705340 no
3d_25C 7d_15C 0.818573 no
3d_25C 7d_30C 0.344277 no
3d_25C 10d_25C 0.536971 no
5d_25C 7d_25C 0.879436 no
5d_25C 7d_15C 0.649060 no
5d_25C 7d_30C 0.519726 no
5d_25C 10d_25C 0.727087 no
7d_25C 7d_15C 0.485946 no
7d_25C 7d_30C 0.672877 no
7d_25C 10d_25C 0.868419 no
7d_15C 7d_30C 0.186413 no
7d_15C 10d_25C 0.330265 no
7d_30C 10d_25C 0.830538 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4703.t1
MAAEGQEIPVEVKAEQIPHQEDGADDEEEIEAMKRRVAEMESEAAKLREMQADLDQQTESLQENKEDIDARSIFV
GNVDYGASPEEIQAHFQSCGSINRVTILLDKFSGQPKGYAYVEFAEPSLVAQALVLNESVFRGRNLKVVPKRTNL
PGMHRGRGRGFGRGRGRGFPRGGGYRGGAPYRGRGRGFSPY*
Coding >Pro_DTO377G3_2|g4703.t1
ATGGCTGCTGAAGGTCAGGAGATTCCAGTGGAGGTCAAGGCGGAGCAGATTCCACACCAGGAAGATGGTGCAGAT
GACGAGGAAGAGATTGAGGCCATGAAGCGACGAGTGGCCGAGATGGAATCCGAGGCCGCCAAGCTGCGGGAGATG
CAAGCCGACCTCGACCAGCAAACCGAGAGCCTCCAAGAGAACAAGGAAGATATTGATGCGCGTAGCATTTTCGTC
GGCAATGTCGACTACGGTGCTTCGCCAGAGGAAATTCAGGCTCATTTCCAGAGCTGTGGTTCCATCAACCGGGTT
ACCATTTTGCTGGACAAGTTTTCTGGCCAGCCCAAAGGTTATGCCTATGTTGAATTTGCGGAACCTAGCCTAGTC
GCTCAGGCTCTGGTGTTGAACGAGAGTGTCTTTCGCGGTCGCAACTTGAAGGTCGTGCCTAAGCGTACCAACCTG
CCTGGGATGCACCGTGGCCGTGGTCGTGGCTTCGGCCGCGGTCGTGGCCGTGGCTTCCCTCGTGGTGGTGGATAT
CGCGGTGGTGCTCCCTACCGGGGCCGAGGCCGTGGTTTCTCGCCCTACTAA
Transcript >Pro_DTO377G3_2|g4703.t1
ATGGCTGCTGAAGGTCAGGAGATTCCAGTGGAGGTCAAGGCGGAGCAGATTCCACACCAGGAAGATGGTGCAGAT
GACGAGGAAGAGATTGAGGCCATGAAGCGACGAGTGGCCGAGATGGAATCCGAGGCCGCCAAGCTGCGGGAGATG
CAAGCCGACCTCGACCAGCAAACCGAGAGCCTCCAAGAGAACAAGGAAGATATTGATGCGCGTAGCATTTTCGTC
GGCAATGTCGACTACGGTGCTTCGCCAGAGGAAATTCAGGCTCATTTCCAGAGCTGTGGTTCCATCAACCGGGTT
ACCATTTTGCTGGACAAGTTTTCTGGCCAGCCCAAAGGTTATGCCTATGTTGAATTTGCGGAACCTAGCCTAGTC
GCTCAGGCTCTGGTGTTGAACGAGAGTGTCTTTCGCGGTCGCAACTTGAAGGTCGTGCCTAAGCGTACCAACCTG
CCTGGGATGCACCGTGGCCGTGGTCGTGGCTTCGGCCGCGGTCGTGGCCGTGGCTTCCCTCGTGGTGGTGGATAT
CGCGGTGGTGCTCCCTACCGGGGCCGAGGCCGTGGTTTCTCGCCCTACTAA
Gene >Pro_DTO377G3_2|g4703.t1
ATGGCTGCTGAAGGTCAGGAGATTCCAGTGGAGGTCAAGGCGGAGCAGATTCCACACCAGGAAGATGGTGCAGAT
GACGAGGTAGGGTTGTTCCGCTGCATTGAAAGCAATTCCACTCTTTGTTCGAGATTTTTGGGTCATTTCTTTCAT
ACCAACGTCGCATACTTTTTCTCATATACAAGGCATACCCCGCTGACATGATTGATCCCTACAGGAAGAGATTGA
GGCCATGAAGCGACGAGTGGCCGAGATGGAATCCGAGGCCGCCAAGCTGCGGGAGATGCAAGCCGACCTCGACCA
GCAAACCGAGAGCCTCCAAGAGAACAAGGAAGATATTGATGCGCGTAGCATTTTCGTCGGCAATGTCGACTACGG
TGCTTCGCCAGAGGAAATTCAGGCTCATTTCCAGAGCTGTGGTTCCATCAACCGGGTTACCATTTTGCTGGACAA
GTTTTCTGGCCAGCCCAAAGGGTGAGATCTGAACAGATGGACTGGAATATATATGGATATGAGCTGACAAGGCGC
TGCAGTTATGCCTATGTTGAATTTGCGGAACCTAGCCTAGTCGCTCAGGCTCTGGTGTTGAACGAGAGTGTCTTT
CGCGGTCGCAACTTGAAGGTCGGTTTATAAATGTTGGTCCTATTCTCTTTACACTCACTTATGTCGATTAACAGG
TCGTGCCTAAGCGTACCAACCTGCCTGGGATGCACCGTGGCCGTGGTCGTGGCTTCGGCCGCGGTCGTGGCCGTG
GCTTCCCTCGTGGTGGTGGATATCGCGGTGGTGCTCCCTACCGGGGCCGAGGCCGTGGTTTCTCGCCCTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail