Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4681.t1
Gene name
Locationscaffold_10:136475..136963
Strand+
Gene length (bp)488
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06842 DUF1242 Protein of unknown function (DUF1242) 1.3E-17 10 44

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 70 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 559.97 275.04 844.90
5d_25C Five days - 25 degrees Celsius 747.90 394.37 1101.44
7d_25C Seven days - 25 degrees Celsius 948.65 522.11 1375.19
10d_25C Ten days - 25 degrees Celsius 1841.51 1099.64 2583.38
7d_15C Seven days - 15 degrees Celsius 578.57 284.63 872.50
7d_30C Seven days - 30 degrees Celsius 719.12 372.93 1065.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.327840 no
3d_25C 7d_25C 0.035449 yes
3d_25C 7d_15C 0.938193 no
3d_25C 7d_30C 0.406550 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.416410 no
5d_25C 7d_15C 0.396350 no
5d_25C 7d_30C 0.921231 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.053871 no
7d_25C 7d_30C 0.323738 no
7d_25C 10d_25C 0.003625 yes
7d_15C 7d_30C 0.491780 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4681.t1
MSALFNFQSLLLVILLIICTSSYAHSIMPGIMDRNQNGIFGIFWKSARVGERLSPYVSICCVVMAVSIFFGD*
Coding >Pro_DTO377G3_2|g4681.t1
ATGTCTGCTCTTTTCAACTTTCAATCGTTGCTTCTCGTGATTCTCCTGATAATCTGCACGAGCAGCTATGCGCAC
TCGATAATGCCGGGGATCATGGACCGGAACCAGAATGGGATCTTTGGGATATTCTGGAAGTCTGCTCGGGTCGGA
GAGCGACTCAGCCCATACGTCAGCATATGCTGTGTCGTGATGGCAGTGTCGATCTTCTTCGGTGATTAA
Transcript >Pro_DTO377G3_2|g4681.t1
ATGTCTGCTCTTTTCAACTTTCAATCGTTGCTTCTCGTGATTCTCCTGATAATCTGCACGAGCAGCTATGCGCAC
TCGATAATGCCGGGGATCATGGACCGGAACCAGAATGGGATCTTTGGGATATTCTGGAAGTCTGCTCGGGTCGGA
GAGCGACTCAGCCCATACGTCAGCATATGCTGTGTCGTGATGGCAGTGTCGATCTTCTTCGGTGATTAA
Gene >Pro_DTO377G3_2|g4681.t1
ATGGTGAGTTTATGTAAATGGCAGAATTTACGAGAGCAACTTTTCTGTGAGAAGTATATGTGGCTTGGCTTTCGC
GTGGCGTTCATGTTGGAACCACAATGATAGTATGATTACTGTGCTAACTATCACACTCACCTAGTCTGCTCTTTT
CAACTTTCAATCGTTGCTTCTCGTGATTCTCCTGATAATCTGCACGAGCAGCTATGCGCACTCGATAATGCCGGG
GATCATGGACCGGAACCAGAATGGGTAGGCGACCACCTGAGGATGCGCATCCGGGATGCAGGAAGATGACGGGGA
GACTGATAGTTCTTTGATGTAGGATCTTTGGGATATTCTGGAAGTCTGCTCGGGTCGGAGAGCGACTCAGCCCAT
ACGTCAGCATATGCTGTGTCGTGATGGCAGTAAGTTCTCTCCACGAGTCCCGATGTATGAAGAAATATACATACT
GATGTTGCATGCAGGTGTCGATCTTCTTCGGTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail