Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g468.t1
Gene name
Locationscaffold_01:1189057..1190971
Strand+
Gene length (bp)1914
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01384 PHO4 Phosphate transporter family 6.5E-105 24 583

GO

GO Term Description Terminal node
GO:0006817 phosphate ion transport Yes
GO:0016020 membrane Yes
GO:0005315 inorganic phosphate transmembrane transporter activity Yes
GO:0015291 secondary active transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0006820 anion transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 84 103 19
3 116 138 22
4 148 170 22
5 182 204 22
6 219 241 22
7 382 399 17
8 479 501 22
9 569 591 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g468.t1
MYLHQYDYIFAIGTLFAMLDAFNNGANDVANSWATSVSSRSISYRQAMVLGTIFEFVGAVAVGARTADTIKNGII
PNSAFKGNAGVQMLAFTCALAAASSWVMWCTKHSAHVSSTYSLISAVAGVGVATVGASQVQWGWNDGKGLGAIFA
GLGMAPVISGCFGAIIFMLIKYVVHVRRNPIPWAVWSAPFFFLVAATICTLSIVYKGSPSLGLSKKPAWYVAAVT
MGTGGGVCLLSAFFFVPFIHSRVIKKDPSVKWWMVIQGPLLFTRPVPNGAEVAKVPNYAVVQEEPEEHESHLPID
EKDPKTGVSSIPGSTEERSIEKLEANQLTYREVMAQSEERHKAKLLQSRGPIGWAMRLLRDNPMGAGEIYELRNL
KCMAKRIPAIITVGLLYGFYYDIHTAQSGNEGTPEGERMKRVYANAEKYPNEVEHTFSFIQIITACTASFAHGAN
DIGNSVGPWAAIYSAWSSGTPAASKSPVPVWQLAVLAICISIGLCTYGYNIMKVMGNKITYHSPSRGSSMEMGAA
ITVLVFSQYSLPVSTSMCITGATVGVGLCNGTYKAVNWQRVFLLLFAWIMTIPIAGTLGGCLMGLVLNAPHFLV*
Coding >Pro_DTO377G3_2|g468.t1
ATGTATCTCCATCAATACGATTACATCTTTGCCATCGGCACGTTGTTTGCTATGCTTGATGCATTCAACAACGGT
GCAAACGATGTTGCCAATTCTTGGGCCACGAGTGTCTCCTCCCGGTCCATCTCCTACCGCCAGGCTATGGTCCTC
GGTACCATCTTCGAGTTTGTCGGAGCTGTCGCTGTCGGTGCCCGTACCGCTGATACTATCAAGAACGGCATCATC
CCCAACTCGGCCTTCAAGGGCAATGCCGGTGTTCAAATGCTCGCCTTCACATGTGCCCTTGCCGCTGCATCCTCA
TGGGTGATGTGGTGTACCAAGCACTCCGCCCACGTCTCCTCCACCTACTCCCTCATCTCTGCTGTCGCCGGTGTC
GGTGTTGCAACTGTTGGCGCTTCCCAGGTCCAGTGGGGCTGGAACGATGGCAAGGGTCTCGGTGCCATCTTCGCT
GGTCTCGGCATGGCTCCTGTCATTTCCGGTTGCTTTGGCGCTATTATCTTCATGCTGATCAAGTACGTCGTGCAT
GTGCGGAGAAACCCTATCCCCTGGGCCGTGTGGAGTGCTCCTTTCTTCTTCCTGGTTGCTGCCACCATTTGCACG
CTCTCCATTGTTTACAAGGGCTCTCCCAGCCTGGGTCTGAGCAAGAAGCCCGCCTGGTACGTTGCCGCCGTCACT
ATGGGCACTGGTGGTGGTGTCTGCCTTTTGTCTGCTTTCTTCTTTGTTCCTTTCATTCACTCCCGCGTGATCAAG
AAGGACCCTAGTGTGAAGTGGTGGATGGTCATCCAGGGCCCTCTGCTCTTCACCCGTCCCGTCCCTAACGGTGCT
GAAGTTGCCAAGGTTCCCAACTACGCCGTGGTGCAAGAGGAACCCGAGGAGCACGAGTCTCACCTGCCTATCGAT
GAGAAGGATCCCAAGACCGGTGTTTCCTCCATCCCAGGCTCCACGGAGGAGCGATCCATTGAAAAGCTCGAGGCC
AATCAGCTCACCTACCGCGAAGTCATGGCCCAATCCGAAGAGCGTCACAAGGCCAAGCTCCTCCAGAGCCGTGGT
CCTATTGGCTGGGCTATGCGCCTTCTCCGCGACAACCCCATGGGCGCTGGTGAGATTTACGAACTCCGCAACCTG
AAGTGCATGGCCAAGCGCATCCCCGCCATCATCACTGTCGGTCTTCTCTATGGTTTCTACTACGACATCCACACT
GCCCAGAGTGGTAACGAGGGTACTCCGGAGGGTGAGCGTATGAAGCGTGTCTATGCCAACGCCGAGAAATACCCC
AATGAGGTCGAACACACCTTCTCCTTCATCCAGATCATCACTGCTTGCACTGCTTCCTTCGCTCACGGCGCCAAC
GATATCGGTAACTCTGTCGGCCCCTGGGCTGCCATCTACTCTGCCTGGTCCAGCGGTACTCCTGCCGCGTCCAAG
TCCCCCGTGCCTGTCTGGCAGCTTGCTGTTCTAGCCATTTGCATTTCCATCGGTCTTTGCACTTATGGATATAAC
ATCATGAAAGTCATGGGTAACAAGATCACCTACCACTCCCCGTCCCGTGGCTCCTCCATGGAGATGGGCGCTGCC
ATCACGGTGCTGGTCTTCTCGCAGTACTCCCTGCCCGTTTCCACTTCTATGTGCATCACTGGCGCTACCGTCGGT
GTTGGACTATGCAACGGAACTTACAAGGCCGTCAACTGGCAGCGTGTCTTCCTTTTGTTGTTCGCATGGATCATG
ACCATCCCCATCGCTGGTACCCTTGGCGGATGCTTGATGGGATTGGTCCTCAACGCTCCCCATTTCCTTGTTTAG
Transcript >Pro_DTO377G3_2|g468.t1
ATGTATCTCCATCAATACGATTACATCTTTGCCATCGGCACGTTGTTTGCTATGCTTGATGCATTCAACAACGGT
GCAAACGATGTTGCCAATTCTTGGGCCACGAGTGTCTCCTCCCGGTCCATCTCCTACCGCCAGGCTATGGTCCTC
GGTACCATCTTCGAGTTTGTCGGAGCTGTCGCTGTCGGTGCCCGTACCGCTGATACTATCAAGAACGGCATCATC
CCCAACTCGGCCTTCAAGGGCAATGCCGGTGTTCAAATGCTCGCCTTCACATGTGCCCTTGCCGCTGCATCCTCA
TGGGTGATGTGGTGTACCAAGCACTCCGCCCACGTCTCCTCCACCTACTCCCTCATCTCTGCTGTCGCCGGTGTC
GGTGTTGCAACTGTTGGCGCTTCCCAGGTCCAGTGGGGCTGGAACGATGGCAAGGGTCTCGGTGCCATCTTCGCT
GGTCTCGGCATGGCTCCTGTCATTTCCGGTTGCTTTGGCGCTATTATCTTCATGCTGATCAAGTACGTCGTGCAT
GTGCGGAGAAACCCTATCCCCTGGGCCGTGTGGAGTGCTCCTTTCTTCTTCCTGGTTGCTGCCACCATTTGCACG
CTCTCCATTGTTTACAAGGGCTCTCCCAGCCTGGGTCTGAGCAAGAAGCCCGCCTGGTACGTTGCCGCCGTCACT
ATGGGCACTGGTGGTGGTGTCTGCCTTTTGTCTGCTTTCTTCTTTGTTCCTTTCATTCACTCCCGCGTGATCAAG
AAGGACCCTAGTGTGAAGTGGTGGATGGTCATCCAGGGCCCTCTGCTCTTCACCCGTCCCGTCCCTAACGGTGCT
GAAGTTGCCAAGGTTCCCAACTACGCCGTGGTGCAAGAGGAACCCGAGGAGCACGAGTCTCACCTGCCTATCGAT
GAGAAGGATCCCAAGACCGGTGTTTCCTCCATCCCAGGCTCCACGGAGGAGCGATCCATTGAAAAGCTCGAGGCC
AATCAGCTCACCTACCGCGAAGTCATGGCCCAATCCGAAGAGCGTCACAAGGCCAAGCTCCTCCAGAGCCGTGGT
CCTATTGGCTGGGCTATGCGCCTTCTCCGCGACAACCCCATGGGCGCTGGTGAGATTTACGAACTCCGCAACCTG
AAGTGCATGGCCAAGCGCATCCCCGCCATCATCACTGTCGGTCTTCTCTATGGTTTCTACTACGACATCCACACT
GCCCAGAGTGGTAACGAGGGTACTCCGGAGGGTGAGCGTATGAAGCGTGTCTATGCCAACGCCGAGAAATACCCC
AATGAGGTCGAACACACCTTCTCCTTCATCCAGATCATCACTGCTTGCACTGCTTCCTTCGCTCACGGCGCCAAC
GATATCGGTAACTCTGTCGGCCCCTGGGCTGCCATCTACTCTGCCTGGTCCAGCGGTACTCCTGCCGCGTCCAAG
TCCCCCGTGCCTGTCTGGCAGCTTGCTGTTCTAGCCATTTGCATTTCCATCGGTCTTTGCACTTATGGATATAAC
ATCATGAAAGTCATGGGTAACAAGATCACCTACCACTCCCCGTCCCGTGGCTCCTCCATGGAGATGGGCGCTGCC
ATCACGGTGCTGGTCTTCTCGCAGTACTCCCTGCCCGTTTCCACTTCTATGTGCATCACTGGCGCTACCGTCGGT
GTTGGACTATGCAACGGAACTTACAAGGCCGTCAACTGGCAGCGTGTCTTCCTTTTGTTGTTCGCATGGATCATG
ACCATCCCCATCGCTGGTACCCTTGGCGGATGCTTGATGGGATTGGTCCTCAACGCTCCCCATTTCCTTGTTTAG
Gene >Pro_DTO377G3_2|g468.t1
ATGTATCTCCATCAATACGATTACATCTTTGCCATCGGCACGTTGTTTGCTATGCTTGATGCATTCAACAACGGT
GCAAGTAAGTAGCAGCCTATCCTTGGATGGTTGACCTCGAACTAACCATTGGATGTCTATAGACGATGTTGCCAA
TTCTTGGGCCACGAGTGTCTCCTCCCGGTCCATCTCCTACCGCCAGGCTATGGTCCTCGGTACCATCTTCGAGTT
TGTCGGAGCTGTCGCTGTCGGTGCCCGTACCGCTGATACTATCAAGAACGGCATCATCCCCAACTCGGCCTTCAA
GGGCAATGCCGGTGTTCAAATGCTCGCCTTCACATGTGCCCTTGCCGCTGCATCCTCATGGGTGATGTGGTGTAC
CAAGCACTCCGCCCACGTCTCCTCCACCTACTCCCTCATCTCTGCTGTCGCCGGTGTCGGTGTTGCAACTGTTGG
CGCTTCCCAGGTCCAGTGGGGCTGGAACGATGGCAAGGGTCTCGGTGCCATCTTCGCTGGTCTCGGCATGGCTCC
TGTCATTTCCGGTTGCTTTGGCGCTATTATCTTCATGCTGATCAAGTACGTCGTGCATGTGCGGAGAAACCCTAT
CCCCTGGGCCGTGTGGAGTGCTCCTTTCTTCTTCCTGGTTGCTGCCACCATTTGCACGCTCTCCATTGTTTACAA
GGGCTCTCCCAGCCTGGGTCTGAGCAAGAAGCCCGCCTGGTACGTTGCCGCCGTCACTATGGGCACTGGTGGTGG
TGTCTGCCTTTTGTCTGCTTTCTTCTTTGTTCCTTTCATTCACTCCCGCGTGATCAAGAAGGACCCTAGTGTGAA
GTGGTGGATGGTCATCCAGGGCCCTCTGCTCTTCACCCGTCCCGTCCCTAACGGTGCTGAAGTTGCCAAGGTTCC
CAACTACGCCGTGGTGCAAGAGGAACCCGAGGAGCACGAGTCTCACCTGCCTATCGATGAGAAGGATCCCAAGAC
CGGTGTTTCCTCCATCCCAGGCTCCACGGAGGAGCGATCCATTGAAAAGCTCGAGGCCAATCAGCTCACCTACCG
CGAAGTCATGGCCCAATCCGAAGAGCGTCACAAGGCCAAGCTCCTCCAGAGCCGTGGTCCTATTGGCTGGGCTAT
GCGCCTTCTCCGCGACAACCCCATGGGCGCTGGTGAGATTTACGAACTCCGCAACCTGAAGTGCATGGCCAAGCG
CATCCCCGCCATCATCACTGTCGGTCTTCTCTATGGTTTCTACTACGACATCCACACTGCCCAGAGTGGTAACGA
GGGTACTCCGGAGGGTGAGCGTATGAAGCGTGTCTATGCCAACGCCGAGAAATACCCCAATGAGGTCGAACACAC
CTTCTCCTTCATCCAGATCATCACTGCTTGCACTGCTTCCTTCGCTCACGGCGCCAACGATATCGGTAACTCTGT
CGGCCCCTGGGCTGCCATCTACTCTGCCTGGTCCAGCGGTACTCCTGCCGCGTCCAAGTCCCCCGTGCCTGTCTG
GCAGCTTGCTGTTCTAGCCATTTGCATTTCCATCGGTCTTTGCACTTATGGATATAACATCATGAAAGGTAAGCA
CCTCTTCCTTCCACATTCCAATCTTCATTTTTACTAACTTTAAACTTAGTCATGGGTAACAAGATCACCTACCAC
TCCCCGTCCCGTGGCTCCTCCATGGAGATGGGCGCTGCCATCACGGTGCTGGTCTTCTCGCAGTACTCCCTGCCC
GTTTCCACTTCTATGTGCATCACTGGCGCTACCGTCGGTGTTGGACTATGCAACGGAACTTACAAGGCCGTCAAC
TGGCAGCGTGTCTTCCTTTTGTTGTTCGCATGGATCATGACCATCCCCATCGCTGGTACCCTTGGCGGATGCTTG
ATGGGATTGGTCCTCAACGCTCCCCATTTCCTTGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail