Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4673.t1
Gene name
Locationscaffold_10:111083..113939
Strand+
Gene length (bp)2856
Transcript length (bp)2856
Coding sequence length (bp)2856
Protein length (aa) 952

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05345 He_PIG Putative Ig domain 4.2E-08 31 110
PF05345 He_PIG Putative Ig domain 4.8E-08 134 224
PF05345 He_PIG Putative Ig domain 2.2E-05 252 312

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 436 458 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4673.t1
MAFFLTIVLAFLSVASAASLSANYPINAQLPPVARVSQPFRFEFAQSTFSNSDADTKYSLLNAPSWLEVDSTSLT
LSGTPHSGDSGAITFKLVASNGSEKDSMDVTLIVTADQGPTVNKPLVPQLQKLGPVSYPATLFIHPGIPFSIEFD
PDTFNNTHPSTIYYGTSPNNAPLPSWVNFDPAALKFVGNSPAFPGAGPQTFTFQLIASDVTGYSAAKMTFELSIG
PHILTFNETVQTFNLTRGEEFNSPNFTSLLSMDGSPTSIKKLAKVDAELPNWLKLDKDNISLSGTPPNNAVNQNI
TIAVTDSFQDQAQLMVRLEFLKLFLDTVDGCEAAIGQEFKFVFNQSIVTDDSVQLEVDLDNDLTWLTYFSDNKTL
YGHVPDDMDPKKYTIPLTAYQGSTKDTMDFILDVLRASDTHSNPTDPFTNSNSPNHKKAGIIAISVVVPFVVILS
LLILFCCWRSRKSSATVEEGPSDSKIPPPRPVRPDVPNCQPSMAERPSRDDNSEDWMSPISPSSIPKLELGPAWN
VSSFDKREHPVNFTIPEPVVPPRSPARNSPTRNSPIRGGFVPLRDPITQEDNPVQTVSPSRKQNNRLSYTNSPVR
RRTTNRSRREPLKPIQARAVKRESLQSSKSKRYSKRSSGISSIASGLPVRFSGAGHGAGGFGPPGHGVVHASWQN
ARASMLSDETSLTNMAPIFSRPPAAGRMRHSMASSLHDNYKRMTLRTVEPDDSILSEADSLEAFVHSRAKHRNSS
NPLFSAQISRRTSSGMRALDRNRSMRSRADTVSVSTFSDEFRQSIQERPLSTAMSASDYGDDSNNNSRFSQYQNS
QFQNQPGLFPLAEGSVYGQSQLSLAQDYRGAISPLPRFWSENSLGSARKLEGQGTSQPQKVNDENAMPPSSSMIS
DLDEHLSRKVSPSKDPDHPWWLSSPLEPPRPPKSADNRGLPVASSGELAFV*
Coding >Pro_DTO377G3_2|g4673.t1
ATGGCGTTCTTTCTCACCATCGTGCTGGCTTTCCTGTCCGTCGCCAGTGCAGCATCACTGTCTGCCAATTATCCT
ATCAACGCGCAATTGCCACCTGTTGCCCGAGTTTCACAGCCTTTCCGATTTGAATTCGCCCAAAGTACTTTCTCC
AACAGTGACGCGGACACTAAATACTCTCTATTAAACGCACCATCATGGCTTGAAGTGGACAGCACCAGTCTCACC
CTATCCGGTACACCGCACTCAGGCGACAGTGGCGCGATCACTTTCAAGCTTGTGGCATCGAATGGATCGGAAAAA
GACAGCATGGACGTTACTCTAATCGTGACAGCAGACCAGGGACCGACGGTGAACAAACCGCTTGTACCTCAGCTG
CAGAAGTTGGGACCGGTCTCATACCCTGCCACGCTGTTCATTCACCCCGGTATTCCATTCTCGATTGAGTTCGAT
CCGGATACCTTCAACAACACGCATCCCTCCACGATCTACTACGGGACATCGCCAAACAACGCCCCGCTACCTTCC
TGGGTCAACTTTGACCCGGCAGCCCTGAAATTTGTTGGAAATAGCCCTGCTTTTCCAGGCGCGGGGCCTCAAACG
TTTACCTTCCAGCTGATCGCATCAGATGTAACTGGATACAGTGCGGCCAAGATGACTTTTGAACTATCGATCGGT
CCCCATATTCTGACATTCAACGAGACTGTCCAGACTTTTAACCTTACGAGGGGAGAGGAGTTCAACAGTCCTAAT
TTCACTAGTCTTCTCTCTATGGATGGTTCGCCAACTTCTATCAAAAAGCTGGCAAAAGTCGATGCTGAACTGCCG
AATTGGTTGAAACTGGATAAGGACAATATATCGCTGAGCGGGACGCCACCGAATAATGCTGTGAACCAGAATATT
ACTATTGCCGTTACAGACTCTTTTCAGGATCAAGCGCAGTTGATGGTTCGCCTAGAATTCCTCAAGCTGTTCCTC
GATACTGTCGATGGCTGCGAGGCCGCGATTGGCCAGGAGTTCAAGTTTGTGTTCAACCAGTCTATTGTCACTGAT
GACTCTGTACAATTGGAGGTCGATTTGGACAACGATCTCACATGGCTTACTTACTTCTCGGACAACAAGACTCTT
TACGGACACGTTCCGGATGACATGGATCCTAAGAAGTATACCATCCCTCTTACTGCATATCAAGGATCGACCAAA
GACACAATGGACTTCATTCTCGATGTGCTGAGAGCCTCGGACACACACTCGAATCCCACAGATCCGTTTACCAAT
TCTAACAGCCCCAACCACAAGAAGGCTGGCATCATAGCCATCTCAGTTGTGGTTCCATTCGTGGTGATTCTGAGT
CTGCTGATTCTCTTCTGCTGCTGGCGTAGTCGCAAGAGCTCAGCCACGGTCGAAGAAGGTCCGTCCGACAGCAAG
ATTCCTCCGCCACGACCTGTTAGGCCAGATGTTCCTAATTGTCAGCCATCCATGGCGGAAAGACCTTCTCGTGAT
GACAATTCCGAAGATTGGATGAGTCCTATCTCCCCATCGTCGATTCCCAAGCTCGAACTTGGGCCCGCGTGGAAC
GTGTCATCATTTGATAAACGGGAGCACCCAGTTAACTTTACTATCCCTGAGCCCGTTGTTCCCCCTCGCTCTCCT
GCTCGCAACTCTCCCACTCGCAACTCTCCCATTCGCGGGGGCTTTGTCCCACTACGAGACCCCATCACCCAAGAG
GACAACCCAGTCCAAACTGTCTCACCTTCCAGGAAGCAAAACAATCGCCTCTCATACACCAACAGCCCTGTGCGT
CGTAGAACCACCAACCGGTCCCGACGAGAGCCATTGAAGCCGATCCAAGCGCGAGCCGTGAAGCGAGAATCTCTC
CAATCATCCAAGTCCAAGAGATACTCAAAGCGCTCAAGCGGTATTTCCTCCATTGCCTCTGGACTACCTGTACGA
TTCAGCGGAGCCGGCCATGGTGCCGGCGGCTTCGGACCTCCTGGACACGGCGTGGTGCACGCATCGTGGCAAAAC
GCACGAGCATCAATGCTGAGCGATGAGACTAGCCTAACAAATATGGCGCCGATTTTCTCGCGTCCGCCAGCAGCA
GGACGCATGCGCCACAGCATGGCATCCAGCCTCCACGACAACTACAAGCGTATGACCCTACGCACTGTTGAGCCC
GACGACTCCATCCTTTCCGAAGCCGACTCCCTCGAAGCCTTTGTCCACAGCCGAGCCAAGCACCGCAACTCCTCC
AACCCTCTCTTCTCCGCGCAAATAAGCCGGCGCACTTCCTCGGGCATGCGCGCACTCGACCGAAACCGCAGCATG
CGGAGTCGTGCCGACACCGTCTCCGTGTCAACCTTCAGCGACGAATTCCGCCAATCCATCCAAGAACGTCCCTTA
TCGACTGCGATGTCCGCCTCTGACTACGGTGACGACAGCAACAACAACAGCCGCTTCTCTCAATATCAGAACTCC
CAATTTCAGAACCAGCCCGGTCTGTTTCCCCTTGCTGAGGGAAGCGTATATGGCCAGAGCCAGTTGAGTCTCGCA
CAAGACTACCGCGGTGCTATCTCCCCGCTGCCGCGGTTCTGGAGCGAGAATAGTCTGGGCAGTGCTCGGAAATTG
GAGGGCCAGGGCACCTCTCAGCCTCAGAAAGTGAATGATGAAAATGCTATGCCGCCCAGCTCGTCTATGATCTCG
GATTTGGACGAACATCTGTCCCGCAAGGTCAGCCCTAGCAAGGACCCTGATCATCCGTGGTGGCTGTCGTCGCCT
CTTGAGCCCCCGCGGCCGCCGAAGAGTGCTGATAATCGGGGTCTTCCTGTAGCCAGCAGTGGAGAGCTGGCATTT
GTTTGA
Transcript >Pro_DTO377G3_2|g4673.t1
ATGGCGTTCTTTCTCACCATCGTGCTGGCTTTCCTGTCCGTCGCCAGTGCAGCATCACTGTCTGCCAATTATCCT
ATCAACGCGCAATTGCCACCTGTTGCCCGAGTTTCACAGCCTTTCCGATTTGAATTCGCCCAAAGTACTTTCTCC
AACAGTGACGCGGACACTAAATACTCTCTATTAAACGCACCATCATGGCTTGAAGTGGACAGCACCAGTCTCACC
CTATCCGGTACACCGCACTCAGGCGACAGTGGCGCGATCACTTTCAAGCTTGTGGCATCGAATGGATCGGAAAAA
GACAGCATGGACGTTACTCTAATCGTGACAGCAGACCAGGGACCGACGGTGAACAAACCGCTTGTACCTCAGCTG
CAGAAGTTGGGACCGGTCTCATACCCTGCCACGCTGTTCATTCACCCCGGTATTCCATTCTCGATTGAGTTCGAT
CCGGATACCTTCAACAACACGCATCCCTCCACGATCTACTACGGGACATCGCCAAACAACGCCCCGCTACCTTCC
TGGGTCAACTTTGACCCGGCAGCCCTGAAATTTGTTGGAAATAGCCCTGCTTTTCCAGGCGCGGGGCCTCAAACG
TTTACCTTCCAGCTGATCGCATCAGATGTAACTGGATACAGTGCGGCCAAGATGACTTTTGAACTATCGATCGGT
CCCCATATTCTGACATTCAACGAGACTGTCCAGACTTTTAACCTTACGAGGGGAGAGGAGTTCAACAGTCCTAAT
TTCACTAGTCTTCTCTCTATGGATGGTTCGCCAACTTCTATCAAAAAGCTGGCAAAAGTCGATGCTGAACTGCCG
AATTGGTTGAAACTGGATAAGGACAATATATCGCTGAGCGGGACGCCACCGAATAATGCTGTGAACCAGAATATT
ACTATTGCCGTTACAGACTCTTTTCAGGATCAAGCGCAGTTGATGGTTCGCCTAGAATTCCTCAAGCTGTTCCTC
GATACTGTCGATGGCTGCGAGGCCGCGATTGGCCAGGAGTTCAAGTTTGTGTTCAACCAGTCTATTGTCACTGAT
GACTCTGTACAATTGGAGGTCGATTTGGACAACGATCTCACATGGCTTACTTACTTCTCGGACAACAAGACTCTT
TACGGACACGTTCCGGATGACATGGATCCTAAGAAGTATACCATCCCTCTTACTGCATATCAAGGATCGACCAAA
GACACAATGGACTTCATTCTCGATGTGCTGAGAGCCTCGGACACACACTCGAATCCCACAGATCCGTTTACCAAT
TCTAACAGCCCCAACCACAAGAAGGCTGGCATCATAGCCATCTCAGTTGTGGTTCCATTCGTGGTGATTCTGAGT
CTGCTGATTCTCTTCTGCTGCTGGCGTAGTCGCAAGAGCTCAGCCACGGTCGAAGAAGGTCCGTCCGACAGCAAG
ATTCCTCCGCCACGACCTGTTAGGCCAGATGTTCCTAATTGTCAGCCATCCATGGCGGAAAGACCTTCTCGTGAT
GACAATTCCGAAGATTGGATGAGTCCTATCTCCCCATCGTCGATTCCCAAGCTCGAACTTGGGCCCGCGTGGAAC
GTGTCATCATTTGATAAACGGGAGCACCCAGTTAACTTTACTATCCCTGAGCCCGTTGTTCCCCCTCGCTCTCCT
GCTCGCAACTCTCCCACTCGCAACTCTCCCATTCGCGGGGGCTTTGTCCCACTACGAGACCCCATCACCCAAGAG
GACAACCCAGTCCAAACTGTCTCACCTTCCAGGAAGCAAAACAATCGCCTCTCATACACCAACAGCCCTGTGCGT
CGTAGAACCACCAACCGGTCCCGACGAGAGCCATTGAAGCCGATCCAAGCGCGAGCCGTGAAGCGAGAATCTCTC
CAATCATCCAAGTCCAAGAGATACTCAAAGCGCTCAAGCGGTATTTCCTCCATTGCCTCTGGACTACCTGTACGA
TTCAGCGGAGCCGGCCATGGTGCCGGCGGCTTCGGACCTCCTGGACACGGCGTGGTGCACGCATCGTGGCAAAAC
GCACGAGCATCAATGCTGAGCGATGAGACTAGCCTAACAAATATGGCGCCGATTTTCTCGCGTCCGCCAGCAGCA
GGACGCATGCGCCACAGCATGGCATCCAGCCTCCACGACAACTACAAGCGTATGACCCTACGCACTGTTGAGCCC
GACGACTCCATCCTTTCCGAAGCCGACTCCCTCGAAGCCTTTGTCCACAGCCGAGCCAAGCACCGCAACTCCTCC
AACCCTCTCTTCTCCGCGCAAATAAGCCGGCGCACTTCCTCGGGCATGCGCGCACTCGACCGAAACCGCAGCATG
CGGAGTCGTGCCGACACCGTCTCCGTGTCAACCTTCAGCGACGAATTCCGCCAATCCATCCAAGAACGTCCCTTA
TCGACTGCGATGTCCGCCTCTGACTACGGTGACGACAGCAACAACAACAGCCGCTTCTCTCAATATCAGAACTCC
CAATTTCAGAACCAGCCCGGTCTGTTTCCCCTTGCTGAGGGAAGCGTATATGGCCAGAGCCAGTTGAGTCTCGCA
CAAGACTACCGCGGTGCTATCTCCCCGCTGCCGCGGTTCTGGAGCGAGAATAGTCTGGGCAGTGCTCGGAAATTG
GAGGGCCAGGGCACCTCTCAGCCTCAGAAAGTGAATGATGAAAATGCTATGCCGCCCAGCTCGTCTATGATCTCG
GATTTGGACGAACATCTGTCCCGCAAGGTCAGCCCTAGCAAGGACCCTGATCATCCGTGGTGGCTGTCGTCGCCT
CTTGAGCCCCCGCGGCCGCCGAAGAGTGCTGATAATCGGGGTCTTCCTGTAGCCAGCAGTGGAGAGCTGGCATTT
GTTTGA
Gene >Pro_DTO377G3_2|g4673.t1
ATGGCGTTCTTTCTCACCATCGTGCTGGCTTTCCTGTCCGTCGCCAGTGCAGCATCACTGTCTGCCAATTATCCT
ATCAACGCGCAATTGCCACCTGTTGCCCGAGTTTCACAGCCTTTCCGATTTGAATTCGCCCAAAGTACTTTCTCC
AACAGTGACGCGGACACTAAATACTCTCTATTAAACGCACCATCATGGCTTGAAGTGGACAGCACCAGTCTCACC
CTATCCGGTACACCGCACTCAGGCGACAGTGGCGCGATCACTTTCAAGCTTGTGGCATCGAATGGATCGGAAAAA
GACAGCATGGACGTTACTCTAATCGTGACAGCAGACCAGGGACCGACGGTGAACAAACCGCTTGTACCTCAGCTG
CAGAAGTTGGGACCGGTCTCATACCCTGCCACGCTGTTCATTCACCCCGGTATTCCATTCTCGATTGAGTTCGAT
CCGGATACCTTCAACAACACGCATCCCTCCACGATCTACTACGGGACATCGCCAAACAACGCCCCGCTACCTTCC
TGGGTCAACTTTGACCCGGCAGCCCTGAAATTTGTTGGAAATAGCCCTGCTTTTCCAGGCGCGGGGCCTCAAACG
TTTACCTTCCAGCTGATCGCATCAGATGTAACTGGATACAGTGCGGCCAAGATGACTTTTGAACTATCGATCGGT
CCCCATATTCTGACATTCAACGAGACTGTCCAGACTTTTAACCTTACGAGGGGAGAGGAGTTCAACAGTCCTAAT
TTCACTAGTCTTCTCTCTATGGATGGTTCGCCAACTTCTATCAAAAAGCTGGCAAAAGTCGATGCTGAACTGCCG
AATTGGTTGAAACTGGATAAGGACAATATATCGCTGAGCGGGACGCCACCGAATAATGCTGTGAACCAGAATATT
ACTATTGCCGTTACAGACTCTTTTCAGGATCAAGCGCAGTTGATGGTTCGCCTAGAATTCCTCAAGCTGTTCCTC
GATACTGTCGATGGCTGCGAGGCCGCGATTGGCCAGGAGTTCAAGTTTGTGTTCAACCAGTCTATTGTCACTGAT
GACTCTGTACAATTGGAGGTCGATTTGGACAACGATCTCACATGGCTTACTTACTTCTCGGACAACAAGACTCTT
TACGGACACGTTCCGGATGACATGGATCCTAAGAAGTATACCATCCCTCTTACTGCATATCAAGGATCGACCAAA
GACACAATGGACTTCATTCTCGATGTGCTGAGAGCCTCGGACACACACTCGAATCCCACAGATCCGTTTACCAAT
TCTAACAGCCCCAACCACAAGAAGGCTGGCATCATAGCCATCTCAGTTGTGGTTCCATTCGTGGTGATTCTGAGT
CTGCTGATTCTCTTCTGCTGCTGGCGTAGTCGCAAGAGCTCAGCCACGGTCGAAGAAGGTCCGTCCGACAGCAAG
ATTCCTCCGCCACGACCTGTTAGGCCAGATGTTCCTAATTGTCAGCCATCCATGGCGGAAAGACCTTCTCGTGAT
GACAATTCCGAAGATTGGATGAGTCCTATCTCCCCATCGTCGATTCCCAAGCTCGAACTTGGGCCCGCGTGGAAC
GTGTCATCATTTGATAAACGGGAGCACCCAGTTAACTTTACTATCCCTGAGCCCGTTGTTCCCCCTCGCTCTCCT
GCTCGCAACTCTCCCACTCGCAACTCTCCCATTCGCGGGGGCTTTGTCCCACTACGAGACCCCATCACCCAAGAG
GACAACCCAGTCCAAACTGTCTCACCTTCCAGGAAGCAAAACAATCGCCTCTCATACACCAACAGCCCTGTGCGT
CGTAGAACCACCAACCGGTCCCGACGAGAGCCATTGAAGCCGATCCAAGCGCGAGCCGTGAAGCGAGAATCTCTC
CAATCATCCAAGTCCAAGAGATACTCAAAGCGCTCAAGCGGTATTTCCTCCATTGCCTCTGGACTACCTGTACGA
TTCAGCGGAGCCGGCCATGGTGCCGGCGGCTTCGGACCTCCTGGACACGGCGTGGTGCACGCATCGTGGCAAAAC
GCACGAGCATCAATGCTGAGCGATGAGACTAGCCTAACAAATATGGCGCCGATTTTCTCGCGTCCGCCAGCAGCA
GGACGCATGCGCCACAGCATGGCATCCAGCCTCCACGACAACTACAAGCGTATGACCCTACGCACTGTTGAGCCC
GACGACTCCATCCTTTCCGAAGCCGACTCCCTCGAAGCCTTTGTCCACAGCCGAGCCAAGCACCGCAACTCCTCC
AACCCTCTCTTCTCCGCGCAAATAAGCCGGCGCACTTCCTCGGGCATGCGCGCACTCGACCGAAACCGCAGCATG
CGGAGTCGTGCCGACACCGTCTCCGTGTCAACCTTCAGCGACGAATTCCGCCAATCCATCCAAGAACGTCCCTTA
TCGACTGCGATGTCCGCCTCTGACTACGGTGACGACAGCAACAACAACAGCCGCTTCTCTCAATATCAGAACTCC
CAATTTCAGAACCAGCCCGGTCTGTTTCCCCTTGCTGAGGGAAGCGTATATGGCCAGAGCCAGTTGAGTCTCGCA
CAAGACTACCGCGGTGCTATCTCCCCGCTGCCGCGGTTCTGGAGCGAGAATAGTCTGGGCAGTGCTCGGAAATTG
GAGGGCCAGGGCACCTCTCAGCCTCAGAAAGTGAATGATGAAAATGCTATGCCGCCCAGCTCGTCTATGATCTCG
GATTTGGACGAACATCTGTCCCGCAAGGTCAGCCCTAGCAAGGACCCTGATCATCCGTGGTGGCTGTCGTCGCCT
CTTGAGCCCCCGCGGCCGCCGAAGAGTGCTGATAATCGGGGTCTTCCTGTAGCCAGCAGTGGAGAGCTGGCATTT
GTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail