Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4652.t1
Gene name
Locationscaffold_10:72893..74910
Strand+
Gene length (bp)2017
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11815 DUF3336 Domain of unknown function (DUF3336) 7.5E-36 37 177
PF01734 Patatin Patatin-like phospholipase 3.5E-13 185 362

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0004806 triglyceride lipase activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0016298 lipase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008152 metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 35.36 20.94 49.78
5d_25C Five days - 25 degrees Celsius 48.71 29.20 68.22
7d_25C Seven days - 25 degrees Celsius 53.54 32.70 74.39
10d_25C Ten days - 25 degrees Celsius 64.59 39.46 89.72
7d_15C Seven days - 15 degrees Celsius 60.43 36.33 84.52
7d_30C Seven days - 30 degrees Celsius 44.93 26.92 62.94

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.170903 no
3d_25C 7d_25C 0.058988 no
3d_25C 7d_15C 0.010735 yes
3d_25C 7d_30C 0.330688 no
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.748931 no
5d_25C 7d_15C 0.387375 no
5d_25C 7d_30C 0.792679 no
5d_25C 10d_25C 0.227800 no
7d_25C 7d_15C 0.668212 no
7d_25C 7d_30C 0.494636 no
7d_25C 10d_25C 0.451504 no
7d_15C 7d_30C 0.198288 no
7d_15C 10d_25C 0.828279 no
7d_30C 10d_25C 0.101996 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4652.t1
MGSWWLGLWNIVGAVWNMLLDVAQFWRYKLSSWWHSKSPRDRLFYTLANAKSYEDWEEAAFELDELQSKDLWRQN
PVSRHYDYRLILGRLEALMSARESEDILTLVNLLRSGLVRNLGNITSTKLFTHAYAGTKLLIDDYITQVALSIQY
VTSVPGAPMHPSGFSSQAKLELLHDTRQAFGRTTLLLQGGSAFGLCHLGVVKALHLQGLLPRIITGTASGAMIAA
LVGIHSEDELLPLLDGEGIDLSAFDTRKMINGGVEESSDSGWVGTFYRRLRRLMKKGYLFDVGVLEECVRANVGD
LTFEEAYARSKRILNITVVTTGKNGTPNLLNYLTAPNVLIWSAAVASNASSSSGLYSPVTIYCKDETGTIVPWPH
TQDAVFRPWRHVHYNEGESPLSRISELFNVNHFVVSQARPYLVPFLRSELNLLDRRQTGWSNLSRSTMRLIMVEL
RHRLRQLDYLGVLPAPVSRILIDETIPGPNLTLVPDLSFWDLRKLFQSPTKAGIADWALKGERGVWPAISALKVR
EAIEIELDRGYQLVRRRRPSDPSVSVAIPKQVNAMNEGVPRRRRGGSENDEGILADRE*
Coding >Pro_DTO377G3_2|g4652.t1
ATGGGGTCCTGGTGGCTCGGACTGTGGAATATAGTTGGGGCAGTCTGGAATATGCTGCTTGACGTTGCTCAGTTC
TGGAGATATAAACTATCATCATGGTGGCATTCCAAATCCCCTCGAGATCGACTCTTCTATACGCTAGCCAACGCG
AAGAGCTATGAGGATTGGGAAGAGGCGGCATTTGAGCTGGACGAGCTACAGAGTAAAGATTTATGGCGCCAAAAC
CCCGTCAGCCGACACTACGACTACCGACTAATCCTCGGCCGACTGGAAGCACTGATGAGCGCGCGCGAGTCAGAA
GACATCCTAACACTAGTAAACCTGCTCCGATCGGGGCTAGTGAGAAATTTGGGAAACATAACCAGCACGAAGTTG
TTCACGCACGCGTACGCAGGAACCAAGCTTCTAATTGACGATTACATCACGCAAGTAGCGCTGTCAATCCAGTAC
GTGACATCCGTACCAGGAGCGCCGATGCATCCGAGCGGGTTCAGCTCCCAAGCGAAGCTGGAGTTGCTGCACGAT
ACGCGGCAGGCGTTTGGACGTACGACGCTGCTGCTGCAGGGCGGGTCTGCGTTTGGGCTGTGTCATCTTGGTGTT
GTGAAGGCGCTGCATTTGCAGGGTTTGTTACCACGGATTATTACGGGCACTGCCAGTGGGGCGATGATTGCTGCG
CTTGTGGGGATTCATTCTGAGGATGAGTTGTTGCCGTTGCTTGATGGGGAGGGGATTGATCTTTCTGCTTTTGAT
ACGCGGAAGATGATTAATGGTGGGGTCGAGGAGAGCTCCGACTCGGGTTGGGTTGGGACGTTTTATCGGAGGTTG
AGGAGATTGATGAAAAAGGGGTATTTGTTTGATGTTGGTGTTTTGGAGGAATGTGTTCGGGCTAATGTTGGGGAT
CTTACGTTCGAAGAGGCATACGCGAGATCGAAGCGCATTTTGAATATCACTGTCGTGACGACGGGGAAAAACGGG
ACACCGAATCTGTTGAATTACTTGACTGCGCCTAATGTGCTTATCTGGTCTGCGGCAGTAGCATCCAACGCCTCT
TCCTCCTCAGGCCTCTACTCACCCGTGACGATCTACTGCAAAGATGAAACAGGCACAATAGTCCCTTGGCCACAC
ACACAAGATGCAGTCTTCCGACCCTGGCGACACGTCCACTACAACGAAGGCGAATCCCCCCTCTCACGGATCTCG
GAACTCTTCAACGTAAACCACTTCGTCGTCTCCCAAGCTCGACCATACCTAGTCCCGTTCCTTCGGTCAGAATTG
AATCTCCTAGACCGACGACAGACAGGCTGGAGTAATCTCTCCCGTTCCACAATGCGACTAATAATGGTCGAACTG
CGCCACCGGCTCCGCCAGCTCGACTACCTAGGCGTGCTACCTGCTCCGGTGAGCAGAATCCTTATCGACGAGACA
ATCCCCGGGCCAAACCTAACTCTCGTCCCGGACTTGAGTTTCTGGGATCTAAGGAAACTGTTCCAGAGTCCGACG
AAAGCCGGCATCGCTGACTGGGCGCTTAAGGGCGAGAGGGGAGTTTGGCCGGCGATTAGTGCCCTGAAGGTTCGG
GAGGCGATTGAGATTGAGCTTGATAGGGGGTATCAGCTTGTTAGGCGGCGTAGACCGAGTGATCCTTCTGTTTCG
GTGGCTATTCCGAAGCAGGTTAACGCTATGAATGAGGGTGTTCCTAGGCGTAGGAGGGGTGGTAGTGAGAATGAC
GAGGGGATTCTCGCTGATCGGGAGTAG
Transcript >Pro_DTO377G3_2|g4652.t1
ATGGGGTCCTGGTGGCTCGGACTGTGGAATATAGTTGGGGCAGTCTGGAATATGCTGCTTGACGTTGCTCAGTTC
TGGAGATATAAACTATCATCATGGTGGCATTCCAAATCCCCTCGAGATCGACTCTTCTATACGCTAGCCAACGCG
AAGAGCTATGAGGATTGGGAAGAGGCGGCATTTGAGCTGGACGAGCTACAGAGTAAAGATTTATGGCGCCAAAAC
CCCGTCAGCCGACACTACGACTACCGACTAATCCTCGGCCGACTGGAAGCACTGATGAGCGCGCGCGAGTCAGAA
GACATCCTAACACTAGTAAACCTGCTCCGATCGGGGCTAGTGAGAAATTTGGGAAACATAACCAGCACGAAGTTG
TTCACGCACGCGTACGCAGGAACCAAGCTTCTAATTGACGATTACATCACGCAAGTAGCGCTGTCAATCCAGTAC
GTGACATCCGTACCAGGAGCGCCGATGCATCCGAGCGGGTTCAGCTCCCAAGCGAAGCTGGAGTTGCTGCACGAT
ACGCGGCAGGCGTTTGGACGTACGACGCTGCTGCTGCAGGGCGGGTCTGCGTTTGGGCTGTGTCATCTTGGTGTT
GTGAAGGCGCTGCATTTGCAGGGTTTGTTACCACGGATTATTACGGGCACTGCCAGTGGGGCGATGATTGCTGCG
CTTGTGGGGATTCATTCTGAGGATGAGTTGTTGCCGTTGCTTGATGGGGAGGGGATTGATCTTTCTGCTTTTGAT
ACGCGGAAGATGATTAATGGTGGGGTCGAGGAGAGCTCCGACTCGGGTTGGGTTGGGACGTTTTATCGGAGGTTG
AGGAGATTGATGAAAAAGGGGTATTTGTTTGATGTTGGTGTTTTGGAGGAATGTGTTCGGGCTAATGTTGGGGAT
CTTACGTTCGAAGAGGCATACGCGAGATCGAAGCGCATTTTGAATATCACTGTCGTGACGACGGGGAAAAACGGG
ACACCGAATCTGTTGAATTACTTGACTGCGCCTAATGTGCTTATCTGGTCTGCGGCAGTAGCATCCAACGCCTCT
TCCTCCTCAGGCCTCTACTCACCCGTGACGATCTACTGCAAAGATGAAACAGGCACAATAGTCCCTTGGCCACAC
ACACAAGATGCAGTCTTCCGACCCTGGCGACACGTCCACTACAACGAAGGCGAATCCCCCCTCTCACGGATCTCG
GAACTCTTCAACGTAAACCACTTCGTCGTCTCCCAAGCTCGACCATACCTAGTCCCGTTCCTTCGGTCAGAATTG
AATCTCCTAGACCGACGACAGACAGGCTGGAGTAATCTCTCCCGTTCCACAATGCGACTAATAATGGTCGAACTG
CGCCACCGGCTCCGCCAGCTCGACTACCTAGGCGTGCTACCTGCTCCGGTGAGCAGAATCCTTATCGACGAGACA
ATCCCCGGGCCAAACCTAACTCTCGTCCCGGACTTGAGTTTCTGGGATCTAAGGAAACTGTTCCAGAGTCCGACG
AAAGCCGGCATCGCTGACTGGGCGCTTAAGGGCGAGAGGGGAGTTTGGCCGGCGATTAGTGCCCTGAAGGTTCGG
GAGGCGATTGAGATTGAGCTTGATAGGGGGTATCAGCTTGTTAGGCGGCGTAGACCGAGTGATCCTTCTGTTTCG
GTGGCTATTCCGAAGCAGGTTAACGCTATGAATGAGGGTGTTCCTAGGCGTAGGAGGGGTGGTAGTGAGAATGAC
GAGGGGATTCTCGCTGATCGGGAGTAG
Gene >Pro_DTO377G3_2|g4652.t1
ATGGGGTCCTGGTGGCTCGGACTGTGGAATATAGTTGGGGCAGTCTGGAATATGCTGCTTGACGTTGCTCAGTTC
TGGAGATATGTGAGTGTTGTGCTGCAATCCCAGTCGGAGTGTCTTATATGCGGAGGTCTGAGCCGGAGATAGCAA
AGACAAAAGACGCACAAGACATAAAACATCGGATATAGTTTCTGATCTGACCTCGAGCTAACATATATATCCTAG
AAACTATCATCATGGTGGCATTCCAAATCCCCTCGAGATCGACTCTTCTATACGCTAGCCAACGCGAAGAGCTAT
GAGGATTGGGAAGAGGCGGCATTTGAGCTGGACGAGCTACAGAGTAAAGATTTATGGTATGAGATTAAACAGAGC
CCTGCTCAAAATGCAATATACCAAACTATAATCTAACCACCTACACAGGCGCCAAAACCCCGTCAGCCGACACTA
CGACTACCGACTAATCCTCGGCCGACTGGAAGCACTGATGAGCGCGCGCGAGTCAGAAGACATCCTAACACTAGT
AAACCTGCTCCGATCGGGGCTAGTGAGAAATTTGGGAAACATAACCAGCACGAAGTTGTTCACGCACGCGTACGC
AGGAACCAAGCTTCTAATTGACGATTACATCACGCAAGTAGCGCTGTCAATCCAGTACGTGACATCCGTACCAGG
AGCGCCGATGCATCCGAGCGGGTTCAGCTCCCAAGCGAAGCTGGAGTTGCTGCACGATACGCGGCAGGCGTTTGG
ACGTACGACGCTGCTGCTGCAGGGCGGGTCTGCGTTTGGGCTGTGTCATCTTGGTGTTGTGAAGGCGCTGCATTT
GCAGGGTTTGTTACCACGGATTATTACGGGCACTGCCAGTGGGGCGATGATTGCTGCGCTTGTGGGGATTCATTC
TGAGGATGAGTTGTTGCCGTTGCTTGATGGGGAGGGGATTGATCTTTCTGCTTTTGATACGCGGAAGATGATTAA
TGGTGGGGTCGAGGAGAGCTCCGACTCGGGTTGGGTTGGGACGTTTTATCGGAGGTTGAGGAGATTGATGAAAAA
GGGGTATTTGTTTGATGTTGGTGTTTTGGAGGAATGTGTTCGGGCTAATGTTGGGGATCTTACGTTCGAAGAGGC
ATACGCGAGATCGAAGCGCATTTTGAATATCACTGTCGTGACGACGGGGAAAAACGGGACACCGAATCTGTTGAA
TTACTTGACTGCGCCTAATGTGGTATGTATTTCTCCCCTTCTCGTTGCCAGTCTCAGTGATATCTAACACCATTC
CTAGCTTATCTGGTCTGCGGCAGTAGCATCCAACGCCTCTTCCTCCTCAGGCCTCTACTCACCCGTGACGATCTA
CTGCAAAGATGAAACAGGCACAATAGTCCCTTGGCCACACACACAAGATGCAGTCTTCCGACCCTGGCGACACGT
CCACTACAACGAAGGCGAATCCCCCCTCTCACGGATCTCGGAACTCTTCAACGTAAACCACTTCGTCGTCTCCCA
AGCTCGACCATACCTAGTCCCGTTCCTTCGGTCAGAATTGAATCTCCTAGACCGACGACAGACAGGCTGGAGTAA
TCTCTCCCGTTCCACAATGCGACTAATAATGGTCGAACTGCGCCACCGGCTCCGCCAGCTCGACTACCTAGGCGT
GCTACCTGCTCCGGTGAGCAGAATCCTTATCGACGAGACAATCCCCGGGCCAAACCTAACTCTCGTCCCGGACTT
GAGTTTCTGGGATCTAAGGAAACTGTTCCAGAGTCCGACGAAAGCCGGCATCGCTGACTGGGCGCTTAAGGGCGA
GAGGGGAGTTTGGCCGGCGATTAGTGCCCTGAAGGTTCGGGAGGCGATTGAGATTGAGCTTGATAGGGGGTATCA
GCTTGTTAGGCGGCGTAGACCGAGTGATCCTTCTGTTTCGGTGGCTATTCCGAAGCAGGTTAACGCTATGAATGA
GGGTGTTCCTAGGCGTAGGAGGGGTGGTAGTGAGAATGACGAGGGGATTCTCGCTGATCGGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail