Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4650.t1
Gene name
Locationscaffold_10:70014..70962
Strand+
Gene length (bp)948
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 1.3E-11 168 233

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0016491 oxidoreductase activity No
GO:0015035 protein-disulfide reductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0015036 disulfide oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 211.56 130.05 293.07
5d_25C Five days - 25 degrees Celsius 277.38 169.30 385.47
7d_25C Seven days - 25 degrees Celsius 326.26 196.99 455.52
10d_25C Ten days - 25 degrees Celsius 453.96 270.69 637.22
7d_15C Seven days - 15 degrees Celsius 245.67 150.64 340.69
7d_30C Seven days - 30 degrees Celsius 298.34 180.76 415.93

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.238276 no
3d_25C 7d_25C 0.043019 yes
3d_25C 7d_15C 0.562213 no
3d_25C 7d_30C 0.106747 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.535833 no
5d_25C 7d_15C 0.655421 no
5d_25C 7d_30C 0.807241 no
5d_25C 10d_25C 0.018560 yes
7d_25C 7d_15C 0.204236 no
7d_25C 7d_30C 0.759288 no
7d_25C 10d_25C 0.146643 no
7d_15C 7d_30C 0.422019 no
7d_15C 10d_25C 0.001278 yes
7d_30C 10d_25C 0.046757 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4650.t1
MPSSQRRLRLIVVVVIALLFMVFYYTGDASKIQNQKFYRSTLDAMKAKEQAKQAKAQEKIQNPVHAPGQNGAAGA
GAGDKVPVAAAEKAAVPPATGNEDTEEIPIAGRTKMTVPKKVNQDKPSEVQSEIKSEEEKEREEKAKREREEKER
KEAEATTELNAILKRAPVIVFSKSYCPYSKKAKVILLEHYSIEPKPFVVELDQHPLGPYLQALLAQSTGRRTVPN
VLVSGKSIGGGDDIAALDQSDELASTLRQMGGKWIVDVSHQAVEKSL*
Coding >Pro_DTO377G3_2|g4650.t1
ATGCCTTCTTCCCAACGGCGGCTTCGACTGATCGTCGTTGTGGTCATCGCGCTTCTTTTTATGGTCTTTTACTAC
ACCGGTGATGCAAGCAAAATCCAAAACCAAAAGTTCTATCGGTCAACCCTCGACGCAATGAAAGCGAAAGAGCAA
GCTAAGCAGGCCAAGGCCCAAGAGAAAATCCAGAATCCCGTGCATGCGCCCGGACAGAATGGCGCTGCGGGTGCG
GGTGCGGGTGACAAGGTGCCTGTCGCTGCGGCCGAGAAAGCTGCTGTTCCTCCTGCTACAGGGAATGAAGATACG
GAGGAGATACCGATTGCGGGGAGGACGAAGATGACCGTTCCCAAGAAGGTGAATCAGGATAAGCCGTCAGAGGTT
CAGTCGGAGATCAAGAGCGAGGAGGAGAAGGAGCGAGAGGAAAAAGCGAAGAGAGAGCGTGAGGAGAAAGAGAGG
AAAGAGGCCGAGGCGACAACAGAGCTTAATGCCATTCTCAAGCGGGCTCCAGTCATCGTATTCTCCAAATCCTAT
TGCCCCTACAGCAAGAAAGCCAAGGTGATCTTGCTGGAGCACTACTCTATCGAGCCGAAGCCATTCGTGGTCGAA
TTGGATCAGCACCCGCTTGGGCCGTATCTGCAGGCCCTGCTCGCACAGAGCACGGGTCGTCGCACTGTGCCGAAT
GTGCTCGTGAGCGGAAAGAGTATAGGTGGTGGAGACGATATTGCGGCATTGGATCAGAGCGACGAGCTGGCTTCG
ACGCTGCGACAAATGGGTGGGAAATGGATCGTGGACGTGTCGCACCAGGCGGTTGAGAAATCACTATGA
Transcript >Pro_DTO377G3_2|g4650.t1
ATGCCTTCTTCCCAACGGCGGCTTCGACTGATCGTCGTTGTGGTCATCGCGCTTCTTTTTATGGTCTTTTACTAC
ACCGGTGATGCAAGCAAAATCCAAAACCAAAAGTTCTATCGGTCAACCCTCGACGCAATGAAAGCGAAAGAGCAA
GCTAAGCAGGCCAAGGCCCAAGAGAAAATCCAGAATCCCGTGCATGCGCCCGGACAGAATGGCGCTGCGGGTGCG
GGTGCGGGTGACAAGGTGCCTGTCGCTGCGGCCGAGAAAGCTGCTGTTCCTCCTGCTACAGGGAATGAAGATACG
GAGGAGATACCGATTGCGGGGAGGACGAAGATGACCGTTCCCAAGAAGGTGAATCAGGATAAGCCGTCAGAGGTT
CAGTCGGAGATCAAGAGCGAGGAGGAGAAGGAGCGAGAGGAAAAAGCGAAGAGAGAGCGTGAGGAGAAAGAGAGG
AAAGAGGCCGAGGCGACAACAGAGCTTAATGCCATTCTCAAGCGGGCTCCAGTCATCGTATTCTCCAAATCCTAT
TGCCCCTACAGCAAGAAAGCCAAGGTGATCTTGCTGGAGCACTACTCTATCGAGCCGAAGCCATTCGTGGTCGAA
TTGGATCAGCACCCGCTTGGGCCGTATCTGCAGGCCCTGCTCGCACAGAGCACGGGTCGTCGCACTGTGCCGAAT
GTGCTCGTGAGCGGAAAGAGTATAGGTGGTGGAGACGATATTGCGGCATTGGATCAGAGCGACGAGCTGGCTTCG
ACGCTGCGACAAATGGGTGGGAAATGGATCGTGGACGTGTCGCACCAGGCGGTTGAGAAATCACTATGA
Gene >Pro_DTO377G3_2|g4650.t1
ATGCCTTCTTCCCAACGGCGGCTTCGACTGATCGTCGTTGTGGTCATCGCGCTTCTTTTTATGGTCTTTTACTAC
ACCGTGCGTCACCGGATCTCCCCCTTCCACACTGTTTCTTCAGATATCTAATACGACGCAATCGGATCCACAGGG
TGATGCAAGCAAAATCCAAAACCAAAAGTTCTATCGGTCAACCCTCGACGCAATGAAAGCGAAAGAGCAAGCTAA
GCAGGCCAAGGCCCAAGAGAAAATCCAGAATCCCGTGCATGCGCCCGGACAGAATGGCGCTGCGGGTGCGGGTGC
GGGTGACAAGGTGCCTGTCGCTGCGGCCGAGAAAGCTGCTGTTCCTCCTGCTACAGGGAATGAAGATACGGAGGA
GATACCGATTGCGGGGAGGACGAAGATGACCGTTCCCAAGAAGGTGAATCAGGATAAGCCGTCAGAGGTTCAGTC
GGAGATCAAGAGCGAGGAGGAGAAGGAGCGAGAGGAAAAAGCGAAGAGAGAGCGTGAGGAGAAAGAGAGGAAAGA
GGCCGAGGCGACAACAGAGCTTAATGCCATTCTCAAGCGGGCTCCAGGTATGTTTCTTTCCCCCGTTTTCCATTT
CTGGCCCGTATCCAATACCAACAACATCCAGTCATCGTATTCTCCAAATCCTATTGCCCCTACAGCAAGAAAGCC
AAGGTGATCTTGCTGGAGCACTACTCTATCGAGCCGAAGCCATTCGTGGTCGAATTGGATCAGCACCCGCTTGGG
CCGTATCTGCAGGCCCTGCTCGCACAGAGCACGGGTCGTCGCACTGTGCCGAATGTGCTCGTGAGCGGAAAGAGT
ATAGGTGGTGGAGACGATATTGCGGCATTGGATCAGAGCGACGAGCTGGCTTCGACGCTGCGACAAATGGGTGGG
AAATGGATCGTGGACGTGTCGCACCAGGCGGTTGAGAAATCACTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail