Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g465.t1
Gene name
Locationscaffold_01:1180709..1184021
Strand+
Gene length (bp)3312
Transcript length (bp)3156
Coding sequence length (bp)3156
Protein length (aa) 1052

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 5.6E-45 854 1027
PF00122 E1-E2_ATPase E1-E2 ATPase 2.5E-38 219 423
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.3E-18 506 593
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.4E-15 443 781
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 7.9E-06 116 162

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 150 172 22
2 182 204 22
3 350 372 22
4 392 414 22
5 827 849 22
6 912 934 22
7 974 996 22
8 1011 1033 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g465.t1
MTPISGARRPYMSLFWSRINPRSKRATKQFTQSFSTFPLDPDTLGNLVLSKDVQEFHAIGGVTGLEEGLRTDVHS
GLSLDETYLGAPANIAASTISTAPTEKTAISELPMSINLHRDAFVDRRKFFGDNRLPIKPSPSFLSLMWAAYNDH
VLFLLTGAAIISLALGLYQTFGTKHTPDNPPVEWVEGVAILVAIVVITLAGAANDYQKECKFRKLNRKQQDRNVW
VLRSARIHEVPISDVVVGDIVHISPGDIVPADGVLIRGHQVKCDESSATGESDPVDKTPIDTRPGGSREIDPFIL
SHTKIVEGVGAYLVLATGTKSSYGRILLSLDTDPGFTPLQVRLSNLAKNIAHFGALAALVLFVILFIKFCVGLRN
STESASEKGQSFLNVFILALTVVVIAVPEGLPLAVTLALSFATTRMMRDHNLVRQLRACETMGQATDICSDKTGT
LTQNQMTVVSGFFGVTSQFTDRVSSPDILDEESTLSVAKCMNHLSSQSRSLLRQSIAINSTAIESRYGGGRQFLG
SQTEAALLRFSQDYLELGQLEFDRASEEVVDVLPFDASRKYMITVVKMANGVYRSYVKGAPEILIEKCVATIAQP
MQGLSTAPITEYGIEQIRQTIAQYASRSLRTIAICFRDVEELPSRDEEETVSFEDLMKEFTFLGILGLRDPLRAD
AWSAVDTSHKAGLTVRMVTGDNLLTARAIAEECGIINSPDDLVMEGDKFRALDESQQKELVPRLKVLARSRPDDK
RVLVQRLKDLGRVVAVTGDGTNDAPALAVADIGFSMGISGTEIAREASSIVLMDDTFSSIVKAIMWGRAVSDAVK
KFLQFQITITFTSVGLAFVSAVANSSQESVLTPVQLMWVNLFQDTLAALALATDPPPRRILDRKPEPTSTPLITP
TMWKMIIGQSVYQMVVTLVLYFAGSSIFSYHGAFQTSQLQTAVFNTYVWMQIFNMYNNRQIERSFNLIEGIHHNW
LFIAITCIMMGAQILIMFVGGRAFSITKLTGDQWAYSIILGAISIPVGFLLQVIPTVIVEKPMTGMRMLWDGLRR
R*
Coding >Pro_DTO377G3_2|g465.t1
ATGACGCCAATTTCGGGAGCCAGGAGGCCTTATATGTCTCTTTTTTGGTCGCGAATAAACCCGCGATCAAAACGT
GCCACGAAACAATTCACTCAATCGTTCTCGACCTTTCCCCTGGATCCTGACACATTAGGCAATCTTGTGTTGTCC
AAAGATGTCCAAGAGTTCCATGCTATTGGTGGCGTAACAGGCTTGGAGGAAGGACTACGAACCGACGTCCACTCC
GGTCTGAGCCTGGACGAGACCTACCTAGGTGCTCCCGCGAACATCGCTGCGAGTACTATAAGCACTGCGCCGACA
GAAAAGACCGCTATCTCTGAGCTTCCTATGTCGATAAATCTTCATCGCGACGCATTCGTCGACAGAAGGAAATTC
TTCGGCGACAATCGCCTACCCATAAAACCATCCCCGAGCTTTCTGTCATTGATGTGGGCAGCCTACAACGATCAC
GTCCTATTCCTCCTAACCGGGGCTGCTATTATCTCGCTTGCTTTGGGGCTGTATCAGACATTCGGAACCAAGCAT
ACTCCCGACAACCCGCCCGTTGAATGGGTGGAGGGGGTTGCCATCCTTGTCGCTATCGTCGTCATTACTCTCGCC
GGTGCCGCGAACGACTATCAAAAAGAGTGCAAGTTTCGGAAGCTCAATAGAAAACAGCAAGATCGCAATGTTTGG
GTTCTTCGATCTGCAAGGATTCATGAGGTTCCCATCTCCGATGTTGTTGTTGGTGATATTGTTCACATCAGTCCT
GGGGATATCGTACCTGCTGATGGAGTATTAATACGAGGTCATCAGGTCAAATGCGATGAGTCCTCGGCAACTGGC
GAGTCTGATCCGGTCGATAAGACCCCCATAGATACCCGTCCTGGTGGCTCTCGTGAGATCGACCCCTTCATCCTC
TCTCATACCAAGATCGTGGAAGGCGTTGGTGCGTACCTCGTCTTGGCTACAGGCACAAAATCAAGCTACGGAAGA
ATCCTTCTCTCTCTCGATACCGACCCAGGCTTCACCCCGCTTCAAGTGCGGCTCAGCAATCTTGCAAAGAATATT
GCCCACTTTGGTGCACTTGCGGCGCTTGTGCTGTTCGTAATCTTGTTCATCAAGTTCTGTGTCGGCCTTCGGAAT
AGCACCGAGTCTGCCTCGGAAAAAGGACAATCTTTCTTGAATGTCTTCATTCTGGCCTTGACCGTCGTTGTGATC
GCAGTCCCCGAAGGACTTCCCTTGGCAGTTACACTCGCCTTGTCATTTGCCACTACTCGAATGATGAGAGATCAC
AACTTGGTTCGACAACTCCGAGCATGCGAAACGATGGGACAAGCCACGGATATCTGTTCAGATAAAACGGGAACG
TTAACACAGAATCAAATGACTGTTGTCTCGGGTTTCTTCGGTGTTACCTCGCAATTTACTGATCGAGTTAGCAGT
CCAGACATTTTAGATGAAGAAAGTACCTTGTCTGTGGCAAAATGCATGAACCATCTCTCGAGTCAATCGAGATCG
CTTTTGAGGCAATCTATCGCGATTAACTCGACTGCAATTGAAAGCCGATATGGCGGAGGTCGGCAGTTTCTTGGT
TCCCAAACAGAGGCCGCCTTATTGAGATTCTCCCAGGACTATCTTGAGCTAGGTCAGCTTGAATTTGATCGCGCG
AGTGAGGAGGTTGTGGATGTTTTACCTTTTGATGCTTCTCGCAAATACATGATCACAGTTGTGAAAATGGCCAAC
GGGGTATATCGATCATATGTGAAAGGTGCTCCCGAGATTCTCATTGAGAAATGTGTGGCCACGATTGCACAGCCA
ATGCAAGGGCTTAGTACTGCTCCAATCACGGAGTATGGTATTGAACAAATACGCCAGACAATTGCTCAGTATGCG
TCACGATCTTTGCGCACGATTGCGATTTGTTTCCGTGATGTAGAGGAGTTACCTTCCAGAGACGAGGAAGAAACT
GTCAGCTTCGAGGATCTGATGAAAGAGTTCACATTTCTAGGAATTCTGGGTCTACGAGACCCTCTCCGAGCCGAT
GCTTGGAGTGCTGTCGACACCAGTCATAAAGCAGGTCTCACTGTACGCATGGTTACCGGTGACAACCTTCTAACA
GCAAGGGCCATCGCAGAAGAATGTGGAATCATCAATAGTCCTGATGATCTTGTGATGGAAGGCGATAAGTTCCGT
GCGCTAGATGAATCACAGCAGAAGGAGCTAGTTCCACGGCTCAAGGTTCTTGCTCGGTCTCGTCCAGACGATAAG
CGGGTTCTAGTCCAACGCCTGAAGGATCTCGGGAGAGTCGTTGCTGTCACTGGAGACGGTACCAATGATGCCCCT
GCCCTTGCAGTTGCTGATATCGGATTCTCGATGGGAATATCTGGCACTGAAATTGCTCGTGAGGCTTCTTCTATT
GTCCTGATGGATGATACATTTTCTTCGATTGTCAAGGCTATCATGTGGGGAAGAGCAGTCAGCGATGCGGTCAAA
AAATTTTTGCAGTTCCAAATTACCATTACCTTCACCTCTGTGGGCCTGGCATTTGTCTCGGCAGTAGCCAACTCA
TCGCAGGAGTCGGTTTTGACGCCAGTGCAGCTCATGTGGGTAAACCTTTTTCAAGACACTCTAGCAGCTCTAGCC
CTGGCAACCGATCCTCCTCCTCGCCGGATCCTTGACCGCAAACCCGAACCAACATCTACGCCGTTAATTACTCCT
ACCATGTGGAAGATGATTATTGGCCAATCTGTGTATCAGATGGTAGTAACACTCGTTCTATACTTTGCGGGCTCT
TCTATCTTCTCTTATCACGGTGCTTTTCAAACATCACAATTACAGACTGCTGTTTTCAACACCTATGTCTGGATG
CAGATATTCAACATGTACAACAATCGACAAATTGAGCGATCATTTAATCTCATCGAAGGGATCCATCATAACTGG
CTCTTTATAGCAATCACCTGCATCATGATGGGCGCTCAGATCCTAATTATGTTTGTTGGCGGGCGGGCATTCTCA
ATTACAAAGTTGACTGGCGATCAATGGGCATATTCTATCATTCTCGGCGCAATATCTATTCCAGTCGGATTCCTT
CTGCAGGTTATTCCTACCGTGATTGTTGAAAAACCAATGACAGGCATGAGGATGCTATGGGACGGCTTGCGGCGT
CGGTGA
Transcript >Pro_DTO377G3_2|g465.t1
ATGACGCCAATTTCGGGAGCCAGGAGGCCTTATATGTCTCTTTTTTGGTCGCGAATAAACCCGCGATCAAAACGT
GCCACGAAACAATTCACTCAATCGTTCTCGACCTTTCCCCTGGATCCTGACACATTAGGCAATCTTGTGTTGTCC
AAAGATGTCCAAGAGTTCCATGCTATTGGTGGCGTAACAGGCTTGGAGGAAGGACTACGAACCGACGTCCACTCC
GGTCTGAGCCTGGACGAGACCTACCTAGGTGCTCCCGCGAACATCGCTGCGAGTACTATAAGCACTGCGCCGACA
GAAAAGACCGCTATCTCTGAGCTTCCTATGTCGATAAATCTTCATCGCGACGCATTCGTCGACAGAAGGAAATTC
TTCGGCGACAATCGCCTACCCATAAAACCATCCCCGAGCTTTCTGTCATTGATGTGGGCAGCCTACAACGATCAC
GTCCTATTCCTCCTAACCGGGGCTGCTATTATCTCGCTTGCTTTGGGGCTGTATCAGACATTCGGAACCAAGCAT
ACTCCCGACAACCCGCCCGTTGAATGGGTGGAGGGGGTTGCCATCCTTGTCGCTATCGTCGTCATTACTCTCGCC
GGTGCCGCGAACGACTATCAAAAAGAGTGCAAGTTTCGGAAGCTCAATAGAAAACAGCAAGATCGCAATGTTTGG
GTTCTTCGATCTGCAAGGATTCATGAGGTTCCCATCTCCGATGTTGTTGTTGGTGATATTGTTCACATCAGTCCT
GGGGATATCGTACCTGCTGATGGAGTATTAATACGAGGTCATCAGGTCAAATGCGATGAGTCCTCGGCAACTGGC
GAGTCTGATCCGGTCGATAAGACCCCCATAGATACCCGTCCTGGTGGCTCTCGTGAGATCGACCCCTTCATCCTC
TCTCATACCAAGATCGTGGAAGGCGTTGGTGCGTACCTCGTCTTGGCTACAGGCACAAAATCAAGCTACGGAAGA
ATCCTTCTCTCTCTCGATACCGACCCAGGCTTCACCCCGCTTCAAGTGCGGCTCAGCAATCTTGCAAAGAATATT
GCCCACTTTGGTGCACTTGCGGCGCTTGTGCTGTTCGTAATCTTGTTCATCAAGTTCTGTGTCGGCCTTCGGAAT
AGCACCGAGTCTGCCTCGGAAAAAGGACAATCTTTCTTGAATGTCTTCATTCTGGCCTTGACCGTCGTTGTGATC
GCAGTCCCCGAAGGACTTCCCTTGGCAGTTACACTCGCCTTGTCATTTGCCACTACTCGAATGATGAGAGATCAC
AACTTGGTTCGACAACTCCGAGCATGCGAAACGATGGGACAAGCCACGGATATCTGTTCAGATAAAACGGGAACG
TTAACACAGAATCAAATGACTGTTGTCTCGGGTTTCTTCGGTGTTACCTCGCAATTTACTGATCGAGTTAGCAGT
CCAGACATTTTAGATGAAGAAAGTACCTTGTCTGTGGCAAAATGCATGAACCATCTCTCGAGTCAATCGAGATCG
CTTTTGAGGCAATCTATCGCGATTAACTCGACTGCAATTGAAAGCCGATATGGCGGAGGTCGGCAGTTTCTTGGT
TCCCAAACAGAGGCCGCCTTATTGAGATTCTCCCAGGACTATCTTGAGCTAGGTCAGCTTGAATTTGATCGCGCG
AGTGAGGAGGTTGTGGATGTTTTACCTTTTGATGCTTCTCGCAAATACATGATCACAGTTGTGAAAATGGCCAAC
GGGGTATATCGATCATATGTGAAAGGTGCTCCCGAGATTCTCATTGAGAAATGTGTGGCCACGATTGCACAGCCA
ATGCAAGGGCTTAGTACTGCTCCAATCACGGAGTATGGTATTGAACAAATACGCCAGACAATTGCTCAGTATGCG
TCACGATCTTTGCGCACGATTGCGATTTGTTTCCGTGATGTAGAGGAGTTACCTTCCAGAGACGAGGAAGAAACT
GTCAGCTTCGAGGATCTGATGAAAGAGTTCACATTTCTAGGAATTCTGGGTCTACGAGACCCTCTCCGAGCCGAT
GCTTGGAGTGCTGTCGACACCAGTCATAAAGCAGGTCTCACTGTACGCATGGTTACCGGTGACAACCTTCTAACA
GCAAGGGCCATCGCAGAAGAATGTGGAATCATCAATAGTCCTGATGATCTTGTGATGGAAGGCGATAAGTTCCGT
GCGCTAGATGAATCACAGCAGAAGGAGCTAGTTCCACGGCTCAAGGTTCTTGCTCGGTCTCGTCCAGACGATAAG
CGGGTTCTAGTCCAACGCCTGAAGGATCTCGGGAGAGTCGTTGCTGTCACTGGAGACGGTACCAATGATGCCCCT
GCCCTTGCAGTTGCTGATATCGGATTCTCGATGGGAATATCTGGCACTGAAATTGCTCGTGAGGCTTCTTCTATT
GTCCTGATGGATGATACATTTTCTTCGATTGTCAAGGCTATCATGTGGGGAAGAGCAGTCAGCGATGCGGTCAAA
AAATTTTTGCAGTTCCAAATTACCATTACCTTCACCTCTGTGGGCCTGGCATTTGTCTCGGCAGTAGCCAACTCA
TCGCAGGAGTCGGTTTTGACGCCAGTGCAGCTCATGTGGGTAAACCTTTTTCAAGACACTCTAGCAGCTCTAGCC
CTGGCAACCGATCCTCCTCCTCGCCGGATCCTTGACCGCAAACCCGAACCAACATCTACGCCGTTAATTACTCCT
ACCATGTGGAAGATGATTATTGGCCAATCTGTGTATCAGATGGTAGTAACACTCGTTCTATACTTTGCGGGCTCT
TCTATCTTCTCTTATCACGGTGCTTTTCAAACATCACAATTACAGACTGCTGTTTTCAACACCTATGTCTGGATG
CAGATATTCAACATGTACAACAATCGACAAATTGAGCGATCATTTAATCTCATCGAAGGGATCCATCATAACTGG
CTCTTTATAGCAATCACCTGCATCATGATGGGCGCTCAGATCCTAATTATGTTTGTTGGCGGGCGGGCATTCTCA
ATTACAAAGTTGACTGGCGATCAATGGGCATATTCTATCATTCTCGGCGCAATATCTATTCCAGTCGGATTCCTT
CTGCAGGTTATTCCTACCGTGATTGTTGAAAAACCAATGACAGGCATGAGGATGCTATGGGACGGCTTGCGGCGT
CGGTGA
Gene >Pro_DTO377G3_2|g465.t1
ATGACGCCAATTTCGGGAGCCAGGAGGCCTTATATGTCTCTTTTTTGGTCGCGAATAGTAAGTTCAACGATGAGC
CTGAGAATGTGTCTTACTGACGATACCCAGAACCCGCGATCAAAACGTGCCACGAAACAATTCACTCAATCGTTC
TCGACCTTTCCCCTGGATCCTGACACATTAGGCAATCTTGTGTTGTCCAAAGATGTCCAAGAGTTCCATGCTATT
GGTGGCGTAACAGGCTTGGAGGAAGGACTACGAACCGACGTCCACTCCGGTCTGAGCCTGGACGAGACCTACCTA
GGTGCTCCCGCGAACATCGCTGCGAGTACTATAAGCACTGCGCCGACAGAAAAGACCGCTATCTCTGAGCTTCCT
ATGTCGATAAATCTTCATCGCGACGCATTCGTCGACAGAAGGAAATTCTTCGGCGACAATCGCCTACCCATAAAA
CCATCCCCGAGCTTTCTGTCATTGATGTGGGCAGCCTACAACGATCACGTCCTATTCCTCCTAACCGGGGCTGCT
ATTATCTCGCTTGCTTTGGGGCTGTATCAGACATTCGGAACCAAGCATACTCCCGACAACCCGCCCGTTGAATGG
GTGGAGGGGGTTGCCATCCTTGTCGCTATCGTCGTCATTACTCTCGCCGGTGCCGCGAACGACTATCAAAAAGAG
TGCAAGTTTCGGAAGCTCAATAGAAAACAGCAAGATCGCAATGTTTGGGTTCTTCGATCTGCAAGGATTCATGAG
GTTCCCATCTCCGATGTTGTTGTTGGTGATATTGTTCACATCAGTCCTGGGGATATCGTACCTGCTGATGGAGTA
TTAATACGAGGTCATCAGGTCAAATGCGATGAGTCCTCGGCAACTGGCGAGTCTGATCCGGTCGATAAGACCCCC
ATAGATACCCGTCCTGGTGGCTCTCGTGAGATCGACCCCTTCATCCTCTCTCATACCAAGATCGTGGAAGGCGTT
GGTGCGTACCTCGTCTTGGCTACAGGCACAAAATCAAGCTACGGAAGAATCCTTCTCTCTCTCGATACCGACCCA
GGCTTCACCCCGCTTCAAGTGCGGCTCAGCAATCTTGCAAAGAATATTGCCCACTTTGGTGCACTTGCGGCGCTT
GTGCTGTTCGTAATCTTGTTCATCAAGTTCTGTGTCGGCCTTCGGAATAGCACCGAGTCTGCCTCGGAAAAAGGA
CAATCTTTCTTGAATGTCTTCATTCTGGCCTTGACCGTCGTTGTGATCGCAGTCCCCGAAGGACTTCCCTTGGCA
GTTACACTCGCCTTGTCATTTGCCACTACTCGAATGATGAGAGATCACAACTTGGTTCGACAACTCCGAGCATGC
GAAACGATGGGACAAGCCACGGATATCTGTTCAGATAAAACGGGAACGTTAACACAGAATCAAATGACTGTTGTC
TCGGGTTTCTTCGGTGTTACCTCGCAATTTACTGATCGAGTTAGCAGTCCAGACATTTTAGATGAAGAAAGTACC
TTGTCTGTGGCAAAATGCATGAACCATCTCTCGAGTCAATCGAGATCGCTTTTGAGGCAATCTATCGCGATTAAC
TCGACTGCAATTGAAAGCCGATATGGCGGAGGTCGGCAGTTTCTTGGTTCCCAAACAGAGGCCGCCTTATTGAGA
TTCTCCCAGGACTATCTTGAGCTAGGTCAGCTTGAATTTGATCGCGCGAGTGAGGAGGTTGTGGATGTTTTACCT
TTTGATGCTTCTCGCAAATACATGATCACAGTTGTGAAAATGGCCAACGGGGTATATCGATCATATGTGAAAGGT
GCTCCCGAGATTCTCATTGAGAAATGTGTGGCCACGATTGCACAGCCAATGCAAGGGCTTAGTACTGCTCCAATC
ACGGAGTATGGTATTGAACAAATACGCCAGACAATTGCTCAGTATGCGTCACGATCTTTGCGCACGATTGCGATT
TGTTTCCGTGATGTAGAGGAGTTACCTTCCAGAGACGAGGAAGAAACTGTCAGCTTCGAGGATCTGATGAAAGAG
TTCACATTTCTAGGAATTCTGGGTCTACGAGACCCTCTCCGAGCCGATGCTTGGAGTGCTGTCGACACCAGTCAT
AAAGCAGGTCTCACTGTACGCATGGTTACCGGTGACAACCTTCTAACAGCAAGGGCCATCGCAGAAGAATGTGGA
ATCATCAATAGTCCTGATGATCTTGTGATGGAAGGCGATAAGTTCCGTGCGCTAGATGAATCACAGCAGAAGGAG
CTAGTTCCACGGCTCAAGGTTCTTGCTCGGTCTCGTCCAGACGATAAGCGGGTTCTAGTCCAACGCCTGAAGGAT
CTCGGGAGAGTCGTTGCTGTCACTGGAGACGGTACCAATGATGCCCCTGCCCTTGCAGTTGCTGATATCGGATTC
TCGATGGGAATATCTGGCACTGAAATTGCTCGTGAGGCTTCTTCTATTGTCCTGATGGATGATACATTTTCTTCG
ATTGTCAAGGCTATCATGTGGGGAAGAGCAGTCAGCGATGCGGTCAAAAAATTTTTGCAGGTAAGCTACTCTATC
AACAAGGAGTATGGATGGCCATCGGTCTAATATCCATTTTCCAGTTCCAAATTACCATTACCTTCACCTCTGTGG
GCCTGGCATTTGTCTCGGCAGTAGCCAACTCATCGCAGGAGTCGGTTTTGACGCCAGTGCAGCTCATGTGGGTAA
ACCTTTTTCAAGACACTCTAGCAGCTCTAGCCCTGGCAACCGATCCTCCTCCTCGCCGGATCCTTGACCGCAAAC
CCGAACCAACATCTACGCCGTTAATTACTCCTACCATGTGGAAGATGATTATTGGCCAATCTGTGTATCAGATGG
TAGTAACACTCGTTCTATACTTTGCGGGCTCTTCTATCTTCTCTTATCACGGTGCTTTTCAAACATCACAATTAC
AGACTGCTGTTTTCAACACCTATGTCTGGATGCAGATATTCAACATGTACAAGTATGTCGATGCTACCTTCAATA
TTTTTGCGTTACTAACCCCAATACAGCAATCGACAAATTGAGCGATCATTTAATCTCATCGAAGGGATCCATCAT
AACTGGCTCTTTATAGCAATCACCTGCATCATGATGGGCGCTCAGATCCTAATTATGTTTGTTGGCGGGCGGGCA
TTCTCAATTACAAAGTTGACTGGCGATCAATGGGCATATTCTATCATTCTCGGCGCAATATCTATTCCAGTCGGA
TTCCTTCTGCAGGTTATTCCTACCGTGATTGTTGAAAAACCAATGACAGGCATGAGGATGCTATGGGACGGCTTG
CGGCGTCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail